KEGG   Laccaria bicolor: LACBIDRAFT_254066Help
Entry
LACBIDRAFT_254066 CDS       T01044                                 

Definition
nitrate reductase (EC:1.7.1.3)
Orthology
K10534  
nitrate reductase (NAD(P)H) [EC:1.7.1.1 1.7.1.2 1.7.1.3]
Organism
lbc  Laccaria bicolor
Pathway
Nitrogen metabolism
Module
Assimilatory nitrate reduction, nitrate => ammonia
Nitrate assimilation
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:lbc00910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 880 aa AA seqDB search
MLEEKIPFEPLSVNLHTPFFPPSLAQQNGPRSLPPQFKFPSLPLEVASSTIDTQDIGSAD
GWIPRDPRLVRLTGKHPFNAEAKLRDLYSAGFFTPSNLFYVRNHGAVPVVNQDRAEKWEL
RIHGLCAKPATLTLKDLRTKFQVVTIPVTLVCAGNRRKEQNIVQQSLGFNWGAGGLSTAL
FTGVYLSDVLEHVHPTKPAKHVIFEGSDELPNGPYGTSQLLSWARDKGKAMLLSWAMNGL
PLEPDHGFPLRLVVPGQIGGRSVKWLSRIEISKTESQHHLHFHDNKVLPTPVGPEKARAE
KNWWYDPRYIIRELNPNSAIARPDHNEVLDPSDMPPDATYQLKGYAYAGGGRRVSRVEIS
WDDGDSWNVAKITYPEDLFRDVAYSDSVYGRLDLTESDLCFCWCFWTFDMNIEILRGSDV
VMVRCMDESLALQPRDMYWNATGMMNNWWFRVRVCQIEDGKLQFEHPTMAGRQEGGWMRR
LKDDGLDPSKPKFFMRQESGIYSIAKGIEQAPDVIMTKPNIKRKIRMEDLTTAEAKQKAW
FVVRGEVYDGSGYFKEHPGGAEAIMLVAGEDATEDFMAIHSSDAKKKLAEFHIGTLVEPY
KMVPQVNISDNDSQGFLNPRVWKKVVVCSIECLPGEAKRIRFALPDPEQPLGLPFGQHIY
LRLRTKAKNSNDREGELIQRTYTPMIQRDARGFMELLVRIYRPTSRSPLGGRMTMEIDRL
SVGDEVEVKGPTGNFTWKGQGMAVMHGKEYQIREVGMICAGTGITPVIQALRGIFSDPLS
KDVRVWVLDVNRSVDDILCREELDQFALEHNSRLRLHHTLTGTPPKGWRYSTGRATDEMI
KRHMPIPGAGKLICIGGPLAMKESVTTSMINMGWDSSVIV
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgctagaggagaagataccttttgaaccattgagcgtaaacctccacacgccgttcttc
cctccatcattagcccaacaaaatggacctcgaagcctgcccccacagttcaaatttcca
tcattgccgctggaggtagcgtcttctacgatagacactcaggatataggatctgcggat
ggttggattccccgtgatcctcggctcgtccggttgacgggaaaacatccattcaacgcg
gaagcgaaactcagggatctgtacagtgcaggatttttcacgcctagcaacctgttttat
gtcaggaatcacggtgctgttcctgtggttaatcaggacagggcggaaaaatgggagctg
aggatacacgggttatgcgcaaagccggcgacattgactctgaaagatttgcgaacaaag
tttcaagtcgtaaccatcccagtaacattggtttgtgctggaaatcgtcgaaaggaacaa
aatattgtccaacagtcgctaggatttaattggggagcgggcggcctctccacagcgctc
tttactggcgtgtatctatctgacgtgttggaacatgttcatccgaccaagcctgcgaag
catgtcatctttgaagggagcgacgagcttcccaatggaccctatggaacaagtcaacta
ctctcctgggctcgggataaggggaaggcaatgctgctatcctgggcgatgaatggtctt
ccactcgagcctgaccatgggtttccgcttcgactcgtggtccctggccagattggcggg
aggtcagtaaaatggctctctcgcatcgaaatatcgaagacggagagtcaacatcacctt
catttccacgataacaaagttttgccgacgcccgtaggacctgagaaagcgcgagcggaa
aagaactggtggtatgacccaagatatatcattcgcgagttgaatcccaatagtgcgatc
gcacgcccagaccacaacgaggttttagacccatccgacatgccgccggatgcaacgtat
caactcaagggatacgcttacgccggcggtggccgtcgtgtttcacgcgtcgaaatctct
tgggacgatggggactcatggaacgttgcgaaaatcacctatcctgaagatctcttccgt
gatgttgcatattccgattccgtatatggtcggttggatttgactgaatctgacctctgc
ttctgttggtgcttttggacttttgatatgaatatagagatattgagaggaagcgatgtg
gtcatggtgagatgcatggatgaatcgctcgctcttcagcctcgcgacatgtattggaat
gcgactggaatgatgaataattggtggtttcgtgttcgcgtctgtcaaattgaagacgga
aagcttcaattcgagcatccaacgatggcgggaaggcaggaaggcggctggatgcggaga
ttgaaagacgatgggttggatccttcgaagcccaaattttttatgcgtcaagagtcggga
atatattccattgcgaaagggatagagcaagcgccagatgtaatcatgaccaaaccgaat
atcaagcggaaaatccgaatggaggacttgacgacggcggaggccaagcagaaagcctgg
ttcgtggtgcgcggggaggtttatgatggcagtggttatttcaaggaacatcctggcggg
gcggaggccatcatgcttgtcgctggagaagatgcaactgaagattttatggcgattcac
agttccgacgccaaaaagaagctcgcagaattccacatcgggacactcgtcgagccatac
aaaatggttccgcaagtcaacatctcagataacgactcccaaggatttcttaatccccga
gtttggaagaaagtcgtggtctgtagcattgaatgcttgccaggagaagccaagcgtatc
cgcttcgctctgcctgatccagaacaaccgctaggcttaccattcggccaacacatatac
ctacgtttgcggactaaagcaaagaattccaatgatcgtgaaggggagctgatacaaagg
acttacacgcccatgattcagagagacgctagaggtttcatggaactactggttagaatt
tatcggccgacgagcagaagcccactgggcggtcgcatgacgatggagatcgataggctt
tctgtaggcgacgaagtggaggtcaaaggcccaactggaaactttacgtggaaaggacaa
gggatggccgtgatgcatggtaaggaatatcagatcagagaggtcggaatgatttgcgcg
gggaccggaattacacctgttattcaagcgctccgtggaatatttagcgacccactgagc
aaggacgtcagagtctgggttctggatgtcaatcgttccgttgacgacatcctttgccgt
gaggagctcgatcaatttgcgttggaacacaattcaaggctccgccttcaccatacgttg
actggcaccccacccaaagggtggcggtattcgacagggagggcgactgatgagatgatc
aagagacatatgccgattcccggagctggcaaattgatttgcattggaggaccgctggcc
atgaaagagtcagtcaccacttcgatgataaatatgggatgggattcttcagtgatagta
tga

DBGET integrated database retrieval system