KEGG   Laccaria bicolor: LACBIDRAFT_254066Help
Entry
LACBIDRAFT_254066 CDS       T01044                                 

Definition
(RefSeq) nitrate reductase
  KO
K10534  nitrate reductase (NAD(P)H) [EC:1.7.1.1 1.7.1.2 1.7.1.3]
Organism
lbc  Laccaria bicolor
Pathway
lbc00910  Nitrogen metabolism
Module
lbc_M00531  Assimilatory nitrate reduction, nitrate => ammonia
lbc_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LACBIDRAFT_254066
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.1  nitrate reductase (NADH)
     LACBIDRAFT_254066
    1.7.1.2  nitrate reductase [NAD(P)H]
     LACBIDRAFT_254066
    1.7.1.3  nitrate reductase (NADPH)
     LACBIDRAFT_254066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_molyb Mo-co_dimer FAD_binding_6 NAD_binding_1 Cyt-b5 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 6082672
NCBI-ProteinID: XP_001887045
JGI: 254066
UniProt: B0DST0
AA seq 880 aa AA seqDB search
MLEEKIPFEPLSVNLHTPFFPPSLAQQNGPRSLPPQFKFPSLPLEVASSTIDTQDIGSAD
GWIPRDPRLVRLTGKHPFNAEAKLRDLYSAGFFTPSNLFYVRNHGAVPVVNQDRAEKWEL
RIHGLCAKPATLTLKDLRTKFQVVTIPVTLVCAGNRRKEQNIVQQSLGFNWGAGGLSTAL
FTGVYLSDVLEHVHPTKPAKHVIFEGSDELPNGPYGTSQLLSWARDKGKAMLLSWAMNGL
PLEPDHGFPLRLVVPGQIGGRSVKWLSRIEISKTESQHHLHFHDNKVLPTPVGPEKARAE
KNWWYDPRYIIRELNPNSAIARPDHNEVLDPSDMPPDATYQLKGYAYAGGGRRVSRVEIS
WDDGDSWNVAKITYPEDLFRDVAYSDSVYGRLDLTESDLCFCWCFWTFDMNIEILRGSDV
VMVRCMDESLALQPRDMYWNATGMMNNWWFRVRVCQIEDGKLQFEHPTMAGRQEGGWMRR
LKDDGLDPSKPKFFMRQESGIYSIAKGIEQAPDVIMTKPNIKRKIRMEDLTTAEAKQKAW
FVVRGEVYDGSGYFKEHPGGAEAIMLVAGEDATEDFMAIHSSDAKKKLAEFHIGTLVEPY
KMVPQVNISDNDSQGFLNPRVWKKVVVCSIECLPGEAKRIRFALPDPEQPLGLPFGQHIY
LRLRTKAKNSNDREGELIQRTYTPMIQRDARGFMELLVRIYRPTSRSPLGGRMTMEIDRL
SVGDEVEVKGPTGNFTWKGQGMAVMHGKEYQIREVGMICAGTGITPVIQALRGIFSDPLS
KDVRVWVLDVNRSVDDILCREELDQFALEHNSRLRLHHTLTGTPPKGWRYSTGRATDEMI
KRHMPIPGAGKLICIGGPLAMKESVTTSMINMGWDSSVIV
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgctagaggagaagataccttttgaaccattgagcgtaaacctccacacgccgttcttc
cctccatcattagcccaacaaaatggacctcgaagcctgcccccacagttcaaatttcca
tcattgccgctggaggtagcgtcttctacgatagacactcaggatataggatctgcggat
ggttggattccccgtgatcctcggctcgtccggttgacgggaaaacatccattcaacgcg
gaagcgaaactcagggatctgtacagtgcaggatttttcacgcctagcaacctgttttat
gtcaggaatcacggtgctgttcctgtggttaatcaggacagggcggaaaaatgggagctg
aggatacacgggttatgcgcaaagccggcgacattgactctgaaagatttgcgaacaaag
tttcaagtcgtaaccatcccagtaacattggtttgtgctggaaatcgtcgaaaggaacaa
aatattgtccaacagtcgctaggatttaattggggagcgggcggcctctccacagcgctc
tttactggcgtgtatctatctgacgtgttggaacatgttcatccgaccaagcctgcgaag
catgtcatctttgaagggagcgacgagcttcccaatggaccctatggaacaagtcaacta
ctctcctgggctcgggataaggggaaggcaatgctgctatcctgggcgatgaatggtctt
ccactcgagcctgaccatgggtttccgcttcgactcgtggtccctggccagattggcggg
aggtcagtaaaatggctctctcgcatcgaaatatcgaagacggagagtcaacatcacctt
catttccacgataacaaagttttgccgacgcccgtaggacctgagaaagcgcgagcggaa
aagaactggtggtatgacccaagatatatcattcgcgagttgaatcccaatagtgcgatc
gcacgcccagaccacaacgaggttttagacccatccgacatgccgccggatgcaacgtat
caactcaagggatacgcttacgccggcggtggccgtcgtgtttcacgcgtcgaaatctct
tgggacgatggggactcatggaacgttgcgaaaatcacctatcctgaagatctcttccgt
gatgttgcatattccgattccgtatatggtcggttggatttgactgaatctgacctctgc
ttctgttggtgcttttggacttttgatatgaatatagagatattgagaggaagcgatgtg
gtcatggtgagatgcatggatgaatcgctcgctcttcagcctcgcgacatgtattggaat
gcgactggaatgatgaataattggtggtttcgtgttcgcgtctgtcaaattgaagacgga
aagcttcaattcgagcatccaacgatggcgggaaggcaggaaggcggctggatgcggaga
ttgaaagacgatgggttggatccttcgaagcccaaattttttatgcgtcaagagtcggga
atatattccattgcgaaagggatagagcaagcgccagatgtaatcatgaccaaaccgaat
atcaagcggaaaatccgaatggaggacttgacgacggcggaggccaagcagaaagcctgg
ttcgtggtgcgcggggaggtttatgatggcagtggttatttcaaggaacatcctggcggg
gcggaggccatcatgcttgtcgctggagaagatgcaactgaagattttatggcgattcac
agttccgacgccaaaaagaagctcgcagaattccacatcgggacactcgtcgagccatac
aaaatggttccgcaagtcaacatctcagataacgactcccaaggatttcttaatccccga
gtttggaagaaagtcgtggtctgtagcattgaatgcttgccaggagaagccaagcgtatc
cgcttcgctctgcctgatccagaacaaccgctaggcttaccattcggccaacacatatac
ctacgtttgcggactaaagcaaagaattccaatgatcgtgaaggggagctgatacaaagg
acttacacgcccatgattcagagagacgctagaggtttcatggaactactggttagaatt
tatcggccgacgagcagaagcccactgggcggtcgcatgacgatggagatcgataggctt
tctgtaggcgacgaagtggaggtcaaaggcccaactggaaactttacgtggaaaggacaa
gggatggccgtgatgcatggtaaggaatatcagatcagagaggtcggaatgatttgcgcg
gggaccggaattacacctgttattcaagcgctccgtggaatatttagcgacccactgagc
aaggacgtcagagtctgggttctggatgtcaatcgttccgttgacgacatcctttgccgt
gaggagctcgatcaatttgcgttggaacacaattcaaggctccgccttcaccatacgttg
actggcaccccacccaaagggtggcggtattcgacagggagggcgactgatgagatgatc
aagagacatatgccgattcccggagctggcaaattgatttgcattggaggaccgctggcc
atgaaagagtcagtcaccacttcgatgataaatatgggatgggattcttcagtgatagta
tga

DBGET integrated database retrieval system