KEGG   Laccaria bicolor: LACBIDRAFT_254745Help
Entry
LACBIDRAFT_254745 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
lbc  Laccaria bicolor
Brite
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LACBIDRAFT_254745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 114 aa AA seqDB search
SAGKAPASTASKLPRPCRIDRWRKGSQEDMLADGEEEARDTSEESYSSYIYKGVHPDTGI
SKKAMAILKSFVNNIFKHIATEPSSTCHVGLRLSHSVFMLITSINFVLQDQIKS
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
tctgctggcaaagccccggcctccaccgcttccaaacttccaaggccctgccgaattgac
agatggcgcaaaggcagccaagaagacatgctggctgatggagaagaagaagcgagagat
acaagtgaggaaagttactcctcttacatctacaagggtgtccaccctgacactggtatc
tccaaaaaggcaatggctatccttaaaagcttcgtgaacaatatcttcaaacacattgct
actgaaccttccagtacatgccatgtaggtcttcgtctctcgcattctgtatttatgtta
attacctccatcaattttgtattacaggatcaaatcaagtcttga

DBGET integrated database retrieval system