KEGG   Laccaria bicolor: LACBIDRAFT_255253Help
Entry
LACBIDRAFT_255253 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
Organism
lbc  Laccaria bicolor
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 344 aa AA seqDB search
MGLQRFLKPSRPKGTYRLHDFIIQRTLGTGSFGRVHLVRSKHNLRFYAIKVLNKERIVKM
KQVEHTNNEQHMLEHVQHPFIINLWGSFQDAGNLYMVMDFVPGGELFTLLRRSNRFPDPV
AKFYAAEVALALNYLHTLDIVYRDLKPENILLNTDGHIKIADFGFAKLCMTTTWTLCGTP
DYLAPEIVNQQRYNKSVDWYALGVLIFEMLSGLPPYHQGDSPPNHLVLYERITRGPAYIK
WPAAFSENATDIILKLMESDPSRRYGNLQHGAGDVFAHPWFREVDWEKLAAREITAPFLP
RINGDGDASAFDQYPEDNAAAAYGLPVSDVYGTVFPDFEYTNPL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggggctacaaaggttcttgaagccctcaagaccgaagggcacctatcgtctacacgat
ttcatcatccaacgtacccttggcacaggaagctttggtcgtgtccatctggttcgcagc
aaacacaatctgcggttttacgcaataaaggttctgaacaaagaacgcatcgtgaaaatg
aaacaggttgagcatacgaataacgagcagcatatgctcgaacatgtacagcatcctttc
atcatcaatctttggggctcgtttcaagatgctggtaatctgtatatggtgatggacttc
gtccccggcggcgagctctttacgcttctacggaggtcgaatcgcttccctgatccggtc
gcaaaattttatgccgctgaagttgccttggcgttaaattatctgcatacgctcgatatc
gtatatcgcgacttgaagccagagaatattctcctcaataccgatggccatatcaagatc
gccgattttggattcgcaaagttgtgtatgacgactacttggacactttgtggtaccccc
gactatcttgcgcccgagatcgtcaaccaacagcgctataacaagagtgtagactggtac
gcgttgggggtcctgatcttcgagatgttatcaggtctacctccgtatcatcaaggcgat
tcgccccccaaccatttggtgctctatgagagaattactagaggcccagcctacatcaag
tggccggcggccttcagcgagaatgcgacagatatcattctcaagctaatggagagcgat
ccctcacggcgttatggcaatctccaacatggggctggagatgtgtttgcccatccttgg
tttagggaggtggactgggagaagctggctgcgagggagattactgcacccttccttcct
agaatcaacggggacggtgacgcatctgcatttgaccaatatcccgaagacaacgcagcc
gcagcatatggcctacccgtctcggacgtgtatggcacggtcttccccgacttcgaatat
acgaatcctttatga

DBGET integrated database retrieval system