KEGG   Laccaria bicolor: LACBIDRAFT_257057Help
Entry
LACBIDRAFT_257057 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
lbc  Laccaria bicolor
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    LACBIDRAFT_257057
  Replication and repair
   03420 Nucleotide excision repair
    LACBIDRAFT_257057
Transcription machinery [BR:lbc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     LACBIDRAFT_257057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 475 aa AA seqDB search
MPSARPYVYADGNVHQRKAHALLPFLQSQSQNTLTKLYSKPSSCLSIFRLLDPISRQLIM
NLLWLESAIPASTMQAWVTREGKPVYTEALATLTKLHIFPNSAIKLAVVPTFKTSFRQAI
TGGGTSGSFGVPSEKDDKRSDVDIEFLDVFALERWETILHYMVSSGSGQNPTKPSVRVLF
LLQRSGLMTTVGQGPLQITSAGFQFLLHSPHEQLWELLLQYLHLTEERQMDLVDVLGFLF
MLSTMELGREYSTERLSKTQTAMLEDLVDYGLIWRRKPSSKGFHPTRLATTLTSSSPPLP
SSIGNRSGPQEGFIVLETNYRIYAYTDNPLQTAILNLFVSLKYRFPNLVVGAITRDSVKK
ALLNGISADQIISYLMSHAHPQMRKNVRLRSCNPLLPVTVQDQIRLWELEKNRLKSQEGY
LYTSFASQADYDFVLNYAKELGVVLWENPVKRCFFGSLDGHANIRGFIERRTGAG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgctcgaccctacgtttacgcagatggaaatgtgcaccaacgaaaagcccat
gcgctgctgcctttccttcaatcccagtcccagaacacgttaacgaaactatactccaag
ccttcgtcatgcctctcaatatttcggctgcttgaccctatatcaaggcaactcatcatg
aacctcctctggctggaatcggccatcccagcttcaaccatgcaagcatgggttacacgg
gaagggaaaccggtatacacggaagctcttgccactctcacaaagcttcacatcttcccg
aattccgcgatcaagttggcggtggttccgacttttaaaacgagttttcggcaagctata
actggggggggcactagtgggagttttggtgttccttcagagaaagacgacaaacgaagt
gacgttgacatcgaatttcttgatgtttttgcgcttgaaagatgggagacgatactgcac
tacatggtttcctccggatcaggacaaaacccaaccaagccctctgtccgtgtattattc
ttactccagcgaagtggtctcatgacgactgttggacaaggccctttgcagataacgtct
gcggggttccaattcctccttcattcgcctcatgagcagctttgggagttgttgctgcag
tatctacaccttactgaggagcgacagatggacttggtcgatgttttagggttcctcttc
atgctatcgaccatggagcttggcagagaatactccacagagcgtctcagtaaaactcaa
acggccatgcttgaagatctggtagactacggcttaatatggcggcgcaagccatcttca
aaaggtttccaccccacccgccttgccacaacattaacatcctcatccccgcctctacct
tcttcaatcggtaaccgctccggcccgcaagaaggattcatcgtgctcgagacgaattac
cggatatacgcctatacagataaccctctgcagactgctatcctcaacctattcgtctcc
ctcaaataccggttcccaaacctcgtggtgggcgccatcacccgagatagtgtaaagaag
gcgctgctgaatgggatctcggcggatcaaatcattagttacctgatgtcccatgctcat
cctcaaatgcgtaaaaatgtaagattgagaagttgtaatccattactccccgtaacggtt
caagaccaaattcgtctctgggaacttgagaaaaaccggctgaaatcacaagaagggtac
ctatacacttctttcgcctctcaagcggactacgatttcgtcctgaactatgctaaagag
ctgggcgtcgtgttgtgggagaacccggtgaagcggtgtttcttcggaagcttggatggg
catgcgaatatcagagggttcattgagaggagaacaggggcgggttaa

DBGET integrated database retrieval system