KEGG   Laccaria bicolor: LACBIDRAFT_291870Help
Entry
LACBIDRAFT_291870 CDS       T01044                                 

Definition
choline kinase, cytoplasm
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
lbc  Laccaria bicolor
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LACBIDRAFT_291870
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     LACBIDRAFT_291870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 474 aa AA seqDB search
MSPYLSPILSPSITTPPSLDTTPSVSRQLSTTSIQGLADFIVCASTSSHLPERRVEVVKE
EGLRHAKISLEARHYKTPVFAAHLLDLLRTLRIPSWSNSAIKSEDIVVRKISGALTNAVF
FVSSIGLVKTNTLLLRIYGPSSGSLISRPRELHTLHMLSSQYHIGPIVYGTFENGRIEEY
FESTTLTPNDIRDPLISRWIGARMAELHSVDIDVVEGNSTQTGEPKGRETGVERNVRSWL
APARQVLALPSISDIVRRDLDLHRFEQEWHRYMLWLSKVDDLHTGRRRVFAHNDTQYGNL
LRLKHPSEGLDEHRQVCDINNYPNYPYRILKLAHLKIIVVDFEYASSNPAAFDIANHFHE
WTANYHSSTPHLLDFTRYPSFQERRNFYIAYVQHTTVLGEDPVMEAPDLERLVLDLDQQV
RNWSPASHAMWAIWGIVQAREDIEGNIADPEFDYIGYARGRLAAFRKEIQILGL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctccttatctatctccgattctttccccctccattaccacacccccgtccttagat
accacaccttctgtctccagacagctctccactacgtccattcagggtctggctgacttc
attgtctgtgcttcgacctcgtcacaccttccagaaaggcgtgtggaggtcgtgaaggaa
gaaggactacgccatgcgaaaattagtttagaagcaagacactataagacacctgtcttt
gctgctcaccttcttgacctattgaggactctccgtataccatcatggtcaaactcagct
atcaagtctgaggacatcgtcgttcgcaaaatctccggggcattgacaaatgctgtcttt
ttcgtatctagcataggtttggtgaaaaccaataccctattactacgcatatacggccct
tcatcgggctctcttatttctcggccccgcgagcttcataccctccatatgttatcatcg
caataccacattgggccgattgtctatggaacgttcgagaatggtcgcatcgaggaatac
tttgaatcaacaaccctaacgcccaatgatatacgagatccattgatcagtcgctggatc
ggtgcccgaatggctgagctccattccgtcgacattgacgtggtggagggaaactcaact
cagaccggagaacccaaagggcgggagacaggggtcgagaggaatgtcaggtcatggtta
gctccagcacgacaagtgctcgcgctaccttccatatctgatatcgtgcgaagagacctc
gatctacatcgttttgaacaggaatggcatagatacatgctgtggctgtccaaagtagac
gatctccatactggtcgtagacgagttttcgctcacaatgacacacaatacggcaacttg
ctgaggttgaagcatccctcggaaggtctcgatgagcatcgacaggtatgtgatataaac
aactatccgaattacccgtatcgcattctaaaattggctcatctgaagatcatcgtcgtt
gattttgaatatgcctcttccaacccggctgcttttgacattgcaaaccactttcacgag
tggacggcaaactatcattcttctacgcctcaccttctagatttcacccgatacccatct
tttcaggaacgacggaacttctatatcgcttatgtgcaacataccacggtgttgggggaa
gatccagtgatggaggcgcctgacctcgagcgcttggttttagaccttgaccaacaggtt
cgcaattggagtccggcgtcccatgcgatgtgggcgatctggggaatcgttcaggcaagg
gaagacatcgagggcaacattgcagatccagagtttgactacataggttacgctagggga
cgacttgcggcttttcgcaaagagattcagattcttgggttgtag

DBGET integrated database retrieval system