KEGG   Laccaria bicolor: LACBIDRAFT_292320Help
Entry
LACBIDRAFT_292320 CDS       T01044                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
lbc  Laccaria bicolor
Pathway
lbc00280  Valine, leucine and isoleucine degradation
lbc00410  beta-Alanine metabolism
lbc00640  Propanoate metabolism
lbc01100  Metabolic pathways
lbc01200  Carbon metabolism
Module
lbc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LACBIDRAFT_292320
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LACBIDRAFT_292320
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LACBIDRAFT_292320
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     LACBIDRAFT_292320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 HEAT_2
Motif
Other DBs
NCBI-GeneID: 6070852
NCBI-ProteinID: XP_001874912
JGI: 292320
UniProt: B0CSR7
AA seq 493 aa AA seqDB search
MPTTAIFRSMTCGAVRTASHRAKAIGHHMMSTTTSSTSEPTVKFESNSALRSYILDRPLK
RNALDEQMLTLLRPKIEEWSASDLCGTIVGRGSGPVFCSGGDVASVVQNAADPATRPKAM
DFFKREFEMDYILAALKKPYVVIMDGVTMGGGVGLAAPAPFRVATENTQFAMPEAKIGYF
PDVGGSYFLSRLDGEIGTYLALTSQTLKGRAVFEYGFATHFIPSRRIPMLLDRLAELDQP
HPSLVDHTLEELSSERDDSEPPALFTGRLRVALDSAFRHDSVERIFKDLRTLLQDGDATV
RQWASDSLEMLAMRSPTSLKVALKAIRRGKRMTLREALEMELKIASAYCSGASPDFDIGV
KAVLIEKLKTRPEWSPSSLEGVSEDIVSRFFEPTSPYVSSAPRLEIPEHLAAEAISIPMR
YALPSENEIGAVIRGSHSSGGEMGTRAEDVLARFAELRPGKLGVKEKVLEVIQRRCKVTD
NADGNFVWLKWIH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgacagctatcttcaggagcatgacctgtggtgctgtgcgcactgcttctcat
cgggcgaaagcgatcggtcatcatatgatgtccacaaccacttcctcaacatcagaaccc
acagtaaaatttgagtccaactcagcacttaggtcgtatattctcgacagaccattgaaa
cgcaatgctcttgacgaacaaatgcttacgcttcttcgtccaaaaattgaggaatggagt
gcatccgatctttgcggtaccatagtcgggaggggatccggtcccgtgttttgttctgga
ggagatgttgcaagcgttgtccaaaatgcggcggatcctgccacccgaccaaaagcaatg
gactttttcaagagagagtttgaaatggactatattctggcagccctcaaaaagccatat
gtggtgattatggatggggtaacaatgggcggtggggtaggacttgcggcaccagctcct
ttcagggtcgcaaccgagaatacgcagtttgctatgcctgaggcaaaaataggatacttt
cctgatgtgggtggaagctacttcctgtcgaggttggatggcgaaattgggacttatctg
gcgctcacgtcgcaaacactgaaaggcagagctgtgttcgagtacggctttgctacgcac
ttcattccttccagacgaatcccgatgcttctcgatcgactcgcagaattagaccaaccg
catccaagcttggttgatcatacccttgaggagctgtcctccgaacgggacgacagtgag
ccccccgcgctgttcaccggaagacttcgcgttgcgcttgattctgcattcaggcatgat
agtgtagaaaggatattcaaagacctgaggacgcttctgcaagacggcgatgccactgtg
aggcagtgggcgtctgatagtctcgaaatgctggcaatgcgaagtcctaccagtctcaag
gtcgcattaaaagcgattcgccgaggcaaaagaatgactcttcgagaagcgttagaaatg
gagctgaagatagcctctgcgtattgtagcggggccagtcctgacttcgacatcggtgtc
aaggcagtacttattgagaagttgaagacaagacccgagtggtcaccttcttctttggaa
ggggtttcagaggatatcgtctcccgcttctttgagccgacgtcgccgtatgtgtcatct
gcacctcgcctggagatcccggaacatttggcagcagaggcgatctcaattccgatgaga
tatgcacttcctagtgaaaacgagatcggtgctgttattcgtggttcccacagttctggc
ggggagatgggcacacgcgcagaagatgtattggcacgattcgcggagttacgtccggga
aaacttggtgtaaaggagaaggttctggaggttatacaacgaaggtgcaaggtcacagat
aacgctgacggcaacttcgtgtggcttaaatggatccactaa

DBGET integrated database retrieval system