KEGG   Laccaria bicolor: LACBIDRAFT_292320Help
Entry
LACBIDRAFT_292320 CDS       T01044                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
lbc  Laccaria bicolor
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lbc01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lbc00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:lbc00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:lbc00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 493 aa AA seqDB search
MPTTAIFRSMTCGAVRTASHRAKAIGHHMMSTTTSSTSEPTVKFESNSALRSYILDRPLK
RNALDEQMLTLLRPKIEEWSASDLCGTIVGRGSGPVFCSGGDVASVVQNAADPATRPKAM
DFFKREFEMDYILAALKKPYVVIMDGVTMGGGVGLAAPAPFRVATENTQFAMPEAKIGYF
PDVGGSYFLSRLDGEIGTYLALTSQTLKGRAVFEYGFATHFIPSRRIPMLLDRLAELDQP
HPSLVDHTLEELSSERDDSEPPALFTGRLRVALDSAFRHDSVERIFKDLRTLLQDGDATV
RQWASDSLEMLAMRSPTSLKVALKAIRRGKRMTLREALEMELKIASAYCSGASPDFDIGV
KAVLIEKLKTRPEWSPSSLEGVSEDIVSRFFEPTSPYVSSAPRLEIPEHLAAEAISIPMR
YALPSENEIGAVIRGSHSSGGEMGTRAEDVLARFAELRPGKLGVKEKVLEVIQRRCKVTD
NADGNFVWLKWIH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgacagctatcttcaggagcatgacctgtggtgctgtgcgcactgcttctcat
cgggcgaaagcgatcggtcatcatatgatgtccacaaccacttcctcaacatcagaaccc
acagtaaaatttgagtccaactcagcacttaggtcgtatattctcgacagaccattgaaa
cgcaatgctcttgacgaacaaatgcttacgcttcttcgtccaaaaattgaggaatggagt
gcatccgatctttgcggtaccatagtcgggaggggatccggtcccgtgttttgttctgga
ggagatgttgcaagcgttgtccaaaatgcggcggatcctgccacccgaccaaaagcaatg
gactttttcaagagagagtttgaaatggactatattctggcagccctcaaaaagccatat
gtggtgattatggatggggtaacaatgggcggtggggtaggacttgcggcaccagctcct
ttcagggtcgcaaccgagaatacgcagtttgctatgcctgaggcaaaaataggatacttt
cctgatgtgggtggaagctacttcctgtcgaggttggatggcgaaattgggacttatctg
gcgctcacgtcgcaaacactgaaaggcagagctgtgttcgagtacggctttgctacgcac
ttcattccttccagacgaatcccgatgcttctcgatcgactcgcagaattagaccaaccg
catccaagcttggttgatcatacccttgaggagctgtcctccgaacgggacgacagtgag
ccccccgcgctgttcaccggaagacttcgcgttgcgcttgattctgcattcaggcatgat
agtgtagaaaggatattcaaagacctgaggacgcttctgcaagacggcgatgccactgtg
aggcagtgggcgtctgatagtctcgaaatgctggcaatgcgaagtcctaccagtctcaag
gtcgcattaaaagcgattcgccgaggcaaaagaatgactcttcgagaagcgttagaaatg
gagctgaagatagcctctgcgtattgtagcggggccagtcctgacttcgacatcggtgtc
aaggcagtacttattgagaagttgaagacaagacccgagtggtcaccttcttctttggaa
ggggtttcagaggatatcgtctcccgcttctttgagccgacgtcgccgtatgtgtcatct
gcacctcgcctggagatcccggaacatttggcagcagaggcgatctcaattccgatgaga
tatgcacttcctagtgaaaacgagatcggtgctgttattcgtggttcccacagttctggc
ggggagatgggcacacgcgcagaagatgtattggcacgattcgcggagttacgtccggga
aaacttggtgtaaaggagaaggttctggaggttatacaacgaaggtgcaaggtcacagat
aacgctgacggcaacttcgtgtggcttaaatggatccactaa

DBGET integrated database retrieval system