KEGG   Laccaria bicolor: LACBIDRAFT_292800Help
Entry
LACBIDRAFT_292800 CDS       T01044                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lbc  Laccaria bicolor
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lbc00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 680 aa AA seqDB search
MPTDALDPNVVLEIDGYLKPNIPAIIQRHNLYRQWKDSIEKHENGFDNFTKGYLKFGLHV
GSQNEVVYREWAPNAKEASLIGDFNEWNRQSHPMKRDDFGVWEVTVPPLPSGVCAIPHDT
KVKISMVLPSGQRIERLPAWISRVTQDLSVSPVYDARFWNPPVSEKYTFKNPRPPKPTNI
RIYEAHVGISTSEPRVGTYKEFTKNTLPRIKDLGYNTIQLMAIMEHAYYASFGYQVTSFF
AASSRYGTPEDLKELIDTAHGLGLTVLLDIVHSHACKNVLDGINEFDGTDHLYFHEGGKG
RHQLWDSRLFNYGSHEVLRFLLSNLRFWVEEYQFDGFRFDGVTSMMYKHHGIGTGFSGGY
HEYFGDGADDEGVVYLMLANDVMHALYPFVITIAEDVSGMPLLSLPVAVGGVGFDYRLSM
AVPDMWIKLLKHKQDDEWDLGNIVHTLINRRHGEKSIAYCESHDQALVGDKTLAFWLMDK
EMYTHMSDLTPMTPIIARGLALHKMIRLLTHSLGGEGYLNFEGNEFGHPEWLDFPREGNN
NSFHYARRQWNVVDDKILRYRYLNNFDREMNHLAGQYGWLDAPQAYVSLKNETDKVLVYE
RAGLLFIFNFHPSNSYTDYRVGVEEAGEYKICLSSDEGRFGGFDNIALDSKFWTTPMEWN
GRKNWLQVYIPSRTCIVLTK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgccaactgatgctctcgatcccaacgttgtccttgagatagatggctatctcaagcca
aacattccagccataatacagaggcacaatctgtatagacagtggaaggacagtattgaa
aaacatgaaaacggtttcgacaacttcacaaagggttatctcaagttcggtcttcatgtc
ggctcccagaacgaagttgtatacagagaatgggcccctaacgctaaggaggcatctctg
attggcgacttcaacgagtggaataggcaatcccatccgatgaagagggatgacttcggt
gtttgggaagtaaccgttccgcccctgccttcaggtgtctgtgctattccccatgacacc
aaagtcaagatttctatggtccttccttctgggcagcgcattgaacgcctcccggcttgg
ataagccgcgttacccaggatttgagcgtttctccagtgtatgacgcacgtttctggaat
ccccctgtttcggaaaaatataccttcaaaaatcctcgccctcccaagcccacgaacatc
aggatctatgaggctcacgttggtatctcgacctctgagccaagagtagggacctacaaa
gagttcacgaagaatactcttcctagaatcaaagatttgggctacaatacaatccagtta
atggctatcatggaacatgcatactacgcatcttttgggtaccaggttaccagctttttc
gcagccagctcccggtatggaacacctgaagacttgaaagagcttattgatacagcccac
ggcttgggtttgactgttcttcttgacattgtccattctcatgcctgcaagaacgtgttg
gatggcataaatgagtttgatggcactgatcatctctatttccacgaaggaggcaaagga
cgtcatcagctatgggacagcaggctttttaactatgggtcccacgaagttcttaggttc
ttgttgagcaaccttcgtttctgggtcgaagaataccagttcgacggcttcaggtttgat
ggtgtcacaagtatgatgtataaacatcatggtatcgggacgggcttctctggggggtac
cacgagtactttggagacggtgccgacgacgaaggcgttgtgtatctcatgcttgccaat
gacgtgatgcatgcgctgtatccattcgtgatcacaatcgcagaagatgtatctggcatg
ccacttcttagtttgcccgttgccgtcgggggcgttggatttgactatcgactctctatg
gcagttcccgacatgtggattaaactattaaagcacaagcaagatgatgaatgggatctt
ggtaacattgtgcatacgttgatcaacagacgccacggcgaaaagagtatagcatattgc
gagagtcatgatcaagctctcgttggcgacaaaacactcgcattttggctcatggataaa
gaaatgtacacgcatatgtctgaccttacacccatgacgcctatcatcgctcgggggctt
gctttgcacaagatgatacgtctgcttacgcattctttgggaggcgaaggttacttgaac
tttgaaggcaatgagtttggtcacccagagtggctggatttccctcgggaagggaataac
aactcattccactatgcgcgccgccaatggaatgtcgtcgacgacaaaattctgcgttac
aggtatctgaacaacttcgatcgcgaaatgaatcatctcgctggtcagtacggttggctt
gacgcaccacaggcgtatgtgtcactgaagaacgaaaccgacaaagttctcgtctacgaa
cgcgctggacttcttttcatctttaacttccacccatccaatagttacacagactaccgc
gtgggagttgaggaagctggggagtataaaatttgcttgagtagtgacgagggtcgattc
ggcggcttcgataacattgcgcttgatagtaagttctggacaactccgatggagtggaat
gggaggaagaactggttacaggtttatattccgtcgaggacatgcatcgttttgacgaag
taa

DBGET integrated database retrieval system