KEGG   Laccaria bicolor: LACBIDRAFT_294311Help
Entry
LACBIDRAFT_294311 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lbc  Laccaria bicolor
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    LACBIDRAFT_294311
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    LACBIDRAFT_294311
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     LACBIDRAFT_294311
Protein phosphatases and associated proteins [BR:lbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     LACBIDRAFT_294311
Transcription machinery [BR:lbc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     LACBIDRAFT_294311
Spliceosome [BR:lbc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    LACBIDRAFT_294311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 331 aa AA seqDB search
MADTTTEIDLDSVIDRLLEVRGNRPGKPVQLQEYEIKYLCTKAREIFINQPILLELEAPI
KICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
ILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPD
LQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKH
DMDLICRAHQVVEDGYEFFAKRHLVTLFSAPNYCGEFDNAGAMMSVDETLLCSFQILKPA
EKKAKYPYGGMNMGRPVTPPRKPKKKDNKMG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcagatacaacgacagagattgatctggactcggtcatcgaccgtctccttgaagtc
cgaggcaaccgaccgggaaaaccggttcaactgcaagaatacgaaatcaaatacttgtgt
acaaaagctcgcgaaattttcatcaaccaacccattcttctcgaacttgaagcccccata
aagatttgtggcgacattcatggccaatattacgacctcctccggctttttgaatatggc
gggttcccaccagaagccaactatcttttccttggtgactacgttgaccgaggaaagcag
tctctcgagactatctgcctcctcctcgcatataagatcaaataccccgaaaatttcttc
atcctgcgaggcaaccacgagtgtgccagtatcaacaggatatacgggttttatgacgaa
tgtaaacgccgttataacattaagttatggaagacgtttacggattgcttcaattgtttg
ccgattgctgccattattgacgagaaaattttcacgatgcatggtggtctgagcccggac
ttgcaatcgatggaacaaatacggagagtaatgcggcccaccgatgtacctgacacaggt
ctgctttgcgatctactttggtccgacccagacaaagatatcactggatggtccgagaac
gacagaggggtgtcattcacattcggaccggacgtggtttcacgattcttgcagaagcat
gacatggatttgatctgtcgagctcatcaggttgtagaggatggctacgagtttttcgcc
aagagacacttagtgactctgttttcagcaccgaactattgtggagagttcgacaacgca
ggagcaatgatgagtgtggacgaaacactactgtgttctttccagattctgaaacctgcc
gagaaaaaggcgaaatacccatatggcgggatgaatatgggacggcctgtgacacctcca
cgcaaaccaaagaagaaggacaacaagatgggctag

DBGET integrated database retrieval system