KEGG   Laccaria bicolor: LACBIDRAFT_294466Help
Entry
LACBIDRAFT_294466 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lbc  Laccaria bicolor
Pathway
lbc00270  Cysteine and methionine metabolism
lbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LACBIDRAFT_294466
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     LACBIDRAFT_294466
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     LACBIDRAFT_294466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_3 Lyx_isomer
Motif
Other DBs
NCBI-GeneID: 6077207
NCBI-ProteinID: XP_001881623
JGI: 294466
UniProt: B0DC57
AA seq 180 aa AA seqDB search
MRAYYYDNIPGDQRLPHDYVPSRPVSEDTLDKINVKHWTIPVEGYESKVNALAQERGYKN
RDTINVSKEGLGEVYEQKIKGFFEEHMHEDEEIRYILSGSGFFDVRETPTDAWIRLAVEP
GDLIVLPAGIYHRFTLDEGNCIKALRLFQDEPKWVPYNRTADTDVNPHRVNYLKSVGVGA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcttactactacgacaacattccaggcgatcagcgcttgcctcacgattacgtc
ccctctcgcccagtctcggaagatacgctcgacaaaatcaacgtcaaacactggacgatc
ccagtcgaggggtacgagagcaaggtgaacgcacttgcgcaggagagaggttataagaac
agagacacgatcaacgtgtcgaaagaaggtcttggcgaggtttatgagcagaaaatcaag
gggttctttgaagagcatatgcatgaggacgaagagatccgctacattttgtcgggaagt
gggttctttgatgtccgtgaaacacctaccgatgcgtggatccgcctggccgttgagcct
ggcgaccttatcgtccttccggctggcatttatcatcggttcaccctggatgaggggaat
tgtatcaaagctctccggctcttccaggatgagcccaagtgggttccttacaatcggact
gcagacaccgacgtcaacccacaccgggttaactacctgaagagcgtcggggtgggtgca
tag

DBGET integrated database retrieval system