KEGG   Laccaria bicolor: LACBIDRAFT_294748Help
Entry
LACBIDRAFT_294748 CDS       T01044                                 

Definition
carbamoyl-phosphate synthase
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
lbc  Laccaria bicolor
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LACBIDRAFT_294748
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LACBIDRAFT_294748
Enzymes [BR:lbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LACBIDRAFT_294748
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     LACBIDRAFT_294748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2171 aa AA seqDB search
MPASPVTAPPMGDHEKTHLDGILELIDGTAYRGFSFGAEGKSIAGECVFQTGMVGYTESL
TDPSYEGQILVLTYPLQGNYGVPSRKSPLNELPKEFESSRIHIAALIVGSYSEDFSHFLA
ESSLGAWLKEGGVPALFGVDTRALTKRIREKGSLLGKVLARAEGTRLNPLPSVPSTPYPW
REEYLDIPYSNPNEQNLVAAVSIAAPKLYKATTKARLHPSGRPLRVIAIDVGMKHNQIRC
FVKRGVELKVVPWDYDFLSDSEPYDGIFISNGPGDPAMVKTTITRLAKAMEEGVLPIFGI
CLGHQLMALAAGATTSKMKYGNRGHNIPCTDALSGRCYITSQNHGFQVDTDTLPSGWKPL
FTNANDQSNEGIYCETKPFFSVQFHPESNAGPRDTEFLFDVFIQNVEDCAATGSTAPLQM
PGGNKEDNARRVPRAKVSKVIILGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTIMVNPN
IATIATSKGLADKVYFLPVTPEFVRKIIKFEKPDGIYVTFGGQTALNVGIKLKDEFAELG
VQVLGTPIETIITTEDRQLFASAMEEIGEKCAESCTATNSDDAVAAAKAIGFPVIVRAAY
ALGGLGSGFAQDEDQLRALCTKAFATSPQVLVEKSMKGWKEIEYEVVRDCRDNCITVCNM
ENFDPLGIHTGDSIVVAPSQTLSDSDYNMLRTTAINVIRHLGVVGECNIQYALNPTSQEY
CIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEIKNSVTKVTSACFEPSLDYVV
VKIPRWDLKKFNRVSRLLSSSMKSVGEVMSIGRTFEETFQKAIRAIDDQFSGFAKNDFVE
DIDEELVNPTDKRVFAISTAFHRGYSIDKIWQMTNIDKWFLNKLQNIFNLEQCLSLTHRT
CNASNLTSDLLRQSKQYGFSDRQIATCISSTELAVRRLRQEAGIAPFVKQIDTVAAEFPA
FTNYLYTTYNAVEHDVEFNERGVMVLGSGVYRIGSSVEFDWCAVRAIRTLRDQGLQTVMV
NYNPETVSTDYDEADRLYFENISLETILDIYDTEQSRGVILSMGGQTPNNIALPLHRQNV
KIYGTSPEMIDTAENRFKFSRLLDEIGVDQPLWKELTSFEDASSFCQAVGYPVLVRPSYV
LSGAAMNVVSTSDDLANYLTQAAEVSRDHPVVISKYIEQAKEIEMDAVAKDGKMVMHYIS
EHVENAGVHSGDATLIHPPQDLDPQTVRQIEEATAKIGNALNVTGPFNIQFIAKNNEIKV
IECNLRAARSFPFVSKVTGVDAIEMATKVMLGIPVEPYPDLNLPPDYVGVKVPQFSFSRL
SGADPILGVEMASTGEVACFGHDKYEAYLKALISTGIVPPKKNILLSIGSYREKLEILPS
VQKLSAAGYNIFATSGTADFLTEHNVACKYLETLGEDSRDEQKSEYSLTQHLANNLIDLY
INLPSKNHYRRPASYTSKGYHTRRMAVDFAIPLITNVKNAKMLAEALVRNMSLDVSNVDA
KTSHRTHTFPGLFNVAAFVPGLITPNSKDLAAATEAAVSAGFTTSIVLPTAISNSISDRP
SLEQARSNALAATHCNIALGITATSSNVDSLDKELQAEVKLLFIPSSTPLSSVAAHFSSW
PAEKPIVTDAKGSELASVLLLASLHNRTVHVTDVRSKDDLILISLSKGRQLKVTCDVSIQ
SLFFTSEQYPGTTSLPSAADQKALWQNLDTIDVFSVGSTPYCLAVESGKLASSESGVEEA
LPLLLTAFTEGRLTLDDIRIRLHDNPVQIFAIPDQTQTHVEVIIGRKTPFSKRSQCWSPL
EQTSVSGSIHRVVFHGQTVFLDGSLFPAALGRDVSATAVAHPTVIPAPSVLKEDISSHAN
AISLTTTSSTHPPAGHHQFTQRDLYDLFALATEIRLQVERTGTLDILKGKVLASIFYEPS
TRTSSSLDAAMKRCGGQVVQVAADNSSVLKGESLPDTIRTLACYGDAIVIRHPDVGSAQL
AAKYSPVPIINAGDGIGEHPTQALLDIYTIRSELGTVNGRTITLLGDLKNGRTVHSLVTL
LCLYSVQLNFVSPRSLAMPSSVISAARKAGIPVTICESLDEVLDDTDVLYITRVQKERFD
DEKEWLQVKDAYRVDHAVLSRAKEDMIVMHPLPRVNEIDPEVDFDSRRAVYFRQMRYGLF
VRMALLASVMA
NT seq 6516 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcatcgccagtcaccgcaccacctatgggtgaccacgaaaagactcacttagac
ggcattctcgaactaatcgacggaactgcctaccgaggctttagctttggtgccgagggg
aagagcatcgcgggcgagtgtgtcttccagactggtatggtcgggtacacggagtcgctg
actgacccctcttatgagggtcagattctcgttctgacctaccctctccaggggaattat
ggagtaccctctcgcaaatcacctctaaatgaacttccaaaagaattcgaatcttctcgt
atccatattgctgcgctaattgtcggctcttactcagaagatttcagccacttccttgcg
gaatcctcacttggagcatggttgaaggagggcggcgtacctgcccttttcggcgtcgat
acccgtgctctcaccaaaaggatcagggagaaagggtctctgctgggaaaagtcctagct
cgcgctgaaggaacgcgacttaatccccttccctcggtcccatccactccctatccttgg
cgagaagaatatttggacattccctacagcaaccctaacgaacaaaatctggtcgcagca
gtctccattgctgcccctaagctttataaagctacgacaaaagcccgacttcatccttcc
ggtcgtccactacgcgtaattgcgatcgacgttgggatgaaacacaaccaaattcgctgc
ttcgttaaacgaggtgttgaactcaaggttgtgccatgggactatgattttctctcagac
tctgaaccgtacgacggaatcttcatttccaacggacctggcgaccccgccatggtcaaa
accaccatcacacgacttgcaaaggccatggaagaaggagttctccccatctttggcatc
tgtttaggccaccagctcatggcgttagctgctggcgctacgacttcaaaaatgaaatac
ggcaatcgcggccacaacatcccatgtaccgacgctctttctggcaggtgctatattacc
agccaaaaccacggtttccaggttgacaccgacactcttccctccggctggaagccactc
tttacgaacgccaacgaccagagcaatgagggtatatattgcgaaaccaagcccttcttc
tctgttcaattccatcctgagtcaaatgccggtcctcgcgatactgaattccttttcgac
gttttcattcagaatgttgaggactgtgctgccacaggatctacggcgcccctccaaatg
cctgggggcaacaaggaagataatgcgagacgtgttcctcgcgccaaagtcagcaaggtc
atcatccttggctcaggcggcttgtccatcggtcaagcaggtgaattcgactactccggt
tcgcaagccataaaggcgctcaaggaggagggaatttacactatcatggtcaaccctaac
atcgccaccatcgcgacatcgaaaggcttggcggacaaagtctacttcttgcccgtcact
ccggagtttgttcgaaaaatcatcaaattcgagaaacctgatggaatctacgtaacattc
ggtggccagacagctctgaacgtcggtattaagttgaaggacgagtttgctgagctcggt
gttcaggttttgggcactcccatagagacaattatcaccacggaggacaggcagctgttt
gcttccgccatggaggagattggcgagaagtgcgccgagagctgtacagcgactaactcg
gatgacgcggttgctgctgcgaaagccattggtttccccgtcatcgttcgtgctgcgtac
gcacttggtggtcttggttctggatttgctcaggacgaggatcagctgcgcgctctttgt
accaaagcattcgcaactagtcctcaagtactggtcgagaagagcatgaagggctggaag
gagattgagtacgaggttgtccgtgattgcagagataactgtatcaccgtttgcaacatg
gagaacttcgatccacttggaatccacactggcgattccatcgttgtggctccatctcaa
acactttcagattcggactataacatgttgcgaacgacggcaatcaacgtcatccgccat
ttgggtgtggttggtgaatgtaatatccagtacgctctcaatcccacttctcaagaatac
tgcattatcgaggttaacgctcgactttcccgttcgtccgccctggcctccaaagctact
ggataccccctcgctttcattgctgctaagcttggccttgggatcccactcaacgagatc
aaaaactccgtcaccaaagtcaccagtgcctgcttcgagccaagtttggactacgtagtc
gtcaagattcctcgctgggatctgaaaaagttcaatcgcgtcagtcgtcttctgagcagc
agcatgaagagtgtgggcgaggttatgagcatcggccgcacatttgaagaaacgttccaa
aaagcgattcgtgcgatagatgatcagttttctgggtttgctaaaaatgatttcgtggag
gatattgatgaagagctcgtcaaccctacggataaacgggtctttgctatatcaacggcc
ttccatcgtggctatagcatcgacaaaatatggcagatgacgaacatcgataaatggttc
ttgaacaagctccaaaacatctttaatctggaacaatgtctttctttgacccatagaact
tgcaacgcctcgaatctaacatcagacctccttcgacaatcgaagcaatatggcttctcg
gatcgtcaaattgctacctgcatcagctcgactgagcttgccgttcgaagactccgtcaa
gaagcgggaatcgctccattcgtcaaacaaattgatactgtggctgcggaattcccggcc
tttaccaactacttatacaccacctacaacgccgttgagcatgacgttgagttcaacgag
aggggtgtcatggttttaggctcaggcgtctatcgcattggctcttctgttgaatttgat
tggtgcgcggtccgtgccatccgcacccttcgtgatcaaggccttcagactgtcatggtc
aactacaaccccgaaaccgtcagcactgattatgacgaggccgataggttgtacttcgag
aacattagcttggagaccatcctcgacatttacgacacagagcaatcacgcggtgtcatc
ctgtctatgggtggtcaaactccaaacaacattgccctgcctttacatcgccagaacgtg
aagatttacgggacctcacccgagatgatcgatactgccgaaaatcgattcaagttctct
cgcctcctcgatgaaatcggtgttgaccagcctttgtggaaggagctcaccagtttcgag
gatgcctctagtttctgccaggccgttggttatcctgtccttgtccggccctcgtacgtt
ctctccggcgctgccatgaacgtcgtgtctacaagtgatgatttggcgaactacttgacc
caagctgctgaggtatcgcgagatcatcctgtcgtcatctccaagtacatcgaacaggcc
aaagagattgagatggacgccgtggcgaaggatggaaagatggttatgcactatatctca
gagcatgtggaaaatgcaggtgttcattcgggtgatgccacgctcatccaccctcctcag
gacttggatccccagactgtccgccagatcgaggaggcgacagcgaagatcggaaacgct
ctgaacgtgactgggcctttcaatatccagttcattgccaagaacaacgagatcaaggtc
atcgagtgtaatctgcgggccgcacggtcgttccccttcgtgtcaaaagtcactggcgtc
gatgcaattgagatggccaccaaagtcatgctcggcatcccagtagagccttatcctgat
ctcaatctcccgcccgactatgttggtgtcaaagtaccccaatttagtttcagtcggctg
tccggggccgaccctatcctaggcgtagagatggcttctactggagaggtggcttgtttc
ggccatgacaagtacgaggcgtatctgaaggcgctgatatcaactggtatcgttccaccc
aagaagaacatacttctctccatcggtagttatcgtgaaaagctcgaaatccttccctcg
gttcagaagctgagcgctgcgggatacaacatatttgccacatccggaactgcagatttt
ctcactgaacataatgttgcttgcaagtatcttgagacccttggagaggacagtcgtgac
gagcaaaagtcggaatattccctcacacagcacttagcgaacaatctcattgacttgtac
atcaatttgccctcgaaaaaccattatcgtcgcccagccagctataccagtaaagggtat
cacacccgcagaatggctgttgacttcgccatccctcttatcaccaatgtcaaaaatgcg
aagatgctcgcagaagccctggtacgcaacatgtccctcgacgtttcgaacgtcgacgcc
aagacttctcatcgtacgcatacattccccggactcttcaacgtggctgcctttgtgccc
ggtcttattactccgaatagcaaggatttggcagcggcaacggaagctgccgtcagcgct
ggttttaccacctctatcgtccttcctactgccatcagcaactccatctctgatcgccca
tctcttgagcaagctcgatccaacgctcttgctgcaacccattgtaacattgcacttgga
atcactgcaacatcgagcaacgttgactctttagacaaagagcttcaagcggaggttaag
ctcttgttcatcccttcctcgacaccactctcttctgtcgctgctcatttttcctcgtgg
cccgcggaaaagccaatcgtcaccgatgccaaagggtctgagctcgcatctgttcttctc
ttggccagtcttcacaaccgcaccgttcatgtcacagacgtacggtccaaggatgatttg
attctgatctccttgagcaaaggaagacaactgaaggtcacctgcgatgtgtcgattcag
tctcttttctttacatcagaacagtacccagggacgacttctcttccctcagctgctgac
cagaaagcattatggcaaaatcttgacacgattgacgtgttctccgtcggttcaacacct
tactgtcttgctgtagaatccggaaagcttgcctcgtccgagtctggtgtagaagaagca
ctgcctctgctcttgacagctttcacagagggacgacttaccctcgatgatatccgcatt
cgtttgcatgataaccccgttcaaattttcgccattccggatcagacccaaacccacgtc
gaagtcattatcggacgcaagactccgttttcgaaacggtcacagtgctggtcacctctg
gaacaaacatcggtttccggatctattcaccgtgtcgtcttccatggacagacggtcttt
ttggatgggtctttgttccctgctgctcttggacgagatgtctcagcaactgccgttgca
catcccactgtcatcccagctccttcggttttaaaagaggatatatcatcacatgcaaac
gccatttcattaacaaccaccagctcaactcatccccctgccggacatcatcaattcact
caaagagatctatacgatctctttgcgcttgcaacggaaataagactccaggtcgaacgc
accggcacgcttgacattctcaaaggcaaggtgctcgccagcatcttctatgaaccttct
actcgcactagctcttctttggacgctgctatgaaacgatgtgggggacaagtggtgcag
gtcgcagcggataattcgtcggttctcaagggagaatcgttgcctgacactattcggacg
ctagcctgttacggagatgcaattgtcatccgtcatcctgatgtaggaagcgcgcagctg
gcagccaaatactctcctgtccccatcatcaatgctggtgatggcatcggagaacaccca
acacaggcactgttggatatttacacaatccgttcggaactgggtactgtcaacgggcgt
accattacactccttggtgacctcaaaaacggacgaacggtccacagtttggtgacattg
ctgtgcctctactccgttcaattgaactttgtttctcctcgttccctcgccatgccttcc
agcgtcatatctgccgccaggaaggcgggaattcctgtcacgatctgtgagtcgctcgac
gaggtgctggacgacacggatgttctgtatattacgcgggtgcagaaggagcgatttgac
gacgagaaggagtggttgcaggtcaaggacgcatatcgagtggaccacgctgttctttcc
agggcaaaggaagatatgattgtcatgcatcccttgccgagagttaatgaaattgaccca
gaagtcgacttcgattccaggcgggcggtgtacttcaggcaaatgcgttatggtcttttc
gttcgcatggcgctgctcgctagtgtcatggcgtag

DBGET integrated database retrieval system