KEGG   Laccaria bicolor: LACBIDRAFT_295043Help
Entry
LACBIDRAFT_295043 CDS       T01044                                 

Definition
delta 9-fatty acid desaturase protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lbc  Laccaria bicolor
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lbc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lbc01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 465 aa AA seqDB search
MPSSTRQQSKLVDESVPADLNIPDNYVQHTLKTIKPLPPVTWSNWTTELDYLNVAILTLT
PVVGLVGAYFTELRWETCLFAIFYYYVTGLGITAGYHRLWAHRAYNASLPLQYFLAIVGA
GAVEGSIKWWSRGHRAHHRYTDTDLDPYNAHRGFFYSHVGWMMIKPRRKPGVADVSDLAK
NPVIRWQHKHYIALIFLMGFILPTVVPWLLWGDAQGGYIYAGVLRLCFVHHSTFCVNSLA
HWLGETPFDDKHTPRDHLITALATIGEGYHNFHHQFPMDYRNAIKWYQYDPTKWFIWACQ
KLGLASHLKVFPDNEVRKGQLTMELKKLRETQEKLSWPNDSNDLPVISWESFQEQALKRP
LILISGFIHDVGTFVDEHPGGPHLLIKFIGKDATTAFFGGVYDHSNAAHNLLAMKRVGVL
HGGAPHGLEDKMIPPSQRLKIARYTELTSPYNSSTAYSDGEGMLG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcctccaccaggcaacagtcgaagctcgtcgacgagtccgttcctgccgacctc
aatattcccgacaactacgtccagcacactctcaaaacaataaaaccccttccacccgtc
acttggagtaactggaccacagagctcgactatctcaacgtcgctatcctcaccctcacc
cccgtcgttggccttgttggtgcctactttacagagctccgttgggaaacctgtcttttc
gctattttctactactacgtgacaggccttggcatcaccgcaggctatcatcgtctgtgg
gctcatcgcgcatacaacgcatcattgcctctgcaatattttttggctatcgttggtgca
ggtgccgttgagggttctatcaagtggtggtcacgaggtcatcgagctcaccaccgttac
accgacaccgaccttgacccttacaatgctcatcgtggctttttttactcccatgtcggt
tggatgatgattaagcccagaaggaagccaggcgtcgcagacgttagcgaccttgcaaag
aatcccgtcattcgctggcaacacaagcattatattgcgctcattttcctcatgggcttc
attcttccaaccgttgttccgtggttattgtggggagatgctcaaggtggatacatatat
gctggtgttctcaggttgtgctttgtccaccactccacattctgcgtcaactcgcttgcg
cattggcttggagagactcctttcgatgacaagcacacacctcgcgaccatctcataacc
gcattggcgacaattggggagggctatcacaatttccaccatcagttccctatggattac
cgaaacgccatcaagtggtaccagtatgaccccaccaagtggttcatctgggcatgtcag
aagcttggcttggcttcccacctcaaggttttccctgacaacgaagtccgaaaaggtcaa
ctaacgatggagttgaagaagcttagggagacgcaggagaagctgtcttggcccaatgat
agcaatgacctgcctgtgatcagttgggaaagcttccaagagcaagctctgaagcgacct
ctcattcttatttccggctttattcacgacgtcggaacatttgttgatgaacatcccggt
ggcccacatttgttgatcaaattcattggcaaggacgctacaacagccttctttggcggt
gtttacgatcactcaaatgctgctcacaacctcctcgcaatgaagcgcgttggtgtcctc
catggaggtgcaccccacggcctggaagataagatgataccacccagtcaacggctgaag
attgcgcggtacaccgagctcacgtctccatacaacagcagcaccgcgtactcggacggg
gaagggatgctcggttga

DBGET integrated database retrieval system