KEGG   Laccaria bicolor: LACBIDRAFT_295043Help
Entry
LACBIDRAFT_295043 CDS       T01044                                 

Definition
delta 9-fatty acid desaturase protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lbc  Laccaria bicolor
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LACBIDRAFT_295043
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LACBIDRAFT_295043
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LACBIDRAFT_295043
Lipid biosynthesis proteins [BR:lbc01004]
 Desaturase
  First
   LACBIDRAFT_295043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 465 aa AA seqDB search
MPSSTRQQSKLVDESVPADLNIPDNYVQHTLKTIKPLPPVTWSNWTTELDYLNVAILTLT
PVVGLVGAYFTELRWETCLFAIFYYYVTGLGITAGYHRLWAHRAYNASLPLQYFLAIVGA
GAVEGSIKWWSRGHRAHHRYTDTDLDPYNAHRGFFYSHVGWMMIKPRRKPGVADVSDLAK
NPVIRWQHKHYIALIFLMGFILPTVVPWLLWGDAQGGYIYAGVLRLCFVHHSTFCVNSLA
HWLGETPFDDKHTPRDHLITALATIGEGYHNFHHQFPMDYRNAIKWYQYDPTKWFIWACQ
KLGLASHLKVFPDNEVRKGQLTMELKKLRETQEKLSWPNDSNDLPVISWESFQEQALKRP
LILISGFIHDVGTFVDEHPGGPHLLIKFIGKDATTAFFGGVYDHSNAAHNLLAMKRVGVL
HGGAPHGLEDKMIPPSQRLKIARYTELTSPYNSSTAYSDGEGMLG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcctccaccaggcaacagtcgaagctcgtcgacgagtccgttcctgccgacctc
aatattcccgacaactacgtccagcacactctcaaaacaataaaaccccttccacccgtc
acttggagtaactggaccacagagctcgactatctcaacgtcgctatcctcaccctcacc
cccgtcgttggccttgttggtgcctactttacagagctccgttgggaaacctgtcttttc
gctattttctactactacgtgacaggccttggcatcaccgcaggctatcatcgtctgtgg
gctcatcgcgcatacaacgcatcattgcctctgcaatattttttggctatcgttggtgca
ggtgccgttgagggttctatcaagtggtggtcacgaggtcatcgagctcaccaccgttac
accgacaccgaccttgacccttacaatgctcatcgtggctttttttactcccatgtcggt
tggatgatgattaagcccagaaggaagccaggcgtcgcagacgttagcgaccttgcaaag
aatcccgtcattcgctggcaacacaagcattatattgcgctcattttcctcatgggcttc
attcttccaaccgttgttccgtggttattgtggggagatgctcaaggtggatacatatat
gctggtgttctcaggttgtgctttgtccaccactccacattctgcgtcaactcgcttgcg
cattggcttggagagactcctttcgatgacaagcacacacctcgcgaccatctcataacc
gcattggcgacaattggggagggctatcacaatttccaccatcagttccctatggattac
cgaaacgccatcaagtggtaccagtatgaccccaccaagtggttcatctgggcatgtcag
aagcttggcttggcttcccacctcaaggttttccctgacaacgaagtccgaaaaggtcaa
ctaacgatggagttgaagaagcttagggagacgcaggagaagctgtcttggcccaatgat
agcaatgacctgcctgtgatcagttgggaaagcttccaagagcaagctctgaagcgacct
ctcattcttatttccggctttattcacgacgtcggaacatttgttgatgaacatcccggt
ggcccacatttgttgatcaaattcattggcaaggacgctacaacagccttctttggcggt
gtttacgatcactcaaatgctgctcacaacctcctcgcaatgaagcgcgttggtgtcctc
catggaggtgcaccccacggcctggaagataagatgataccacccagtcaacggctgaag
attgcgcggtacaccgagctcacgtctccatacaacagcagcaccgcgtactcggacggg
gaagggatgctcggttga

DBGET integrated database retrieval system