KEGG   Laccaria bicolor: LACBIDRAFT_295069Help
Entry
LACBIDRAFT_295069 CDS       T01044                                 

Gene name
R1
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
lbc  Laccaria bicolor
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    LACBIDRAFT_295069 (R1)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LACBIDRAFT_295069 (R1)
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     LACBIDRAFT_295069 (R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 586 aa AA seqDB search
MSRFVISGPGGGAPNRLEIRTFVQHDKYFSLYIQALQLMYTKESQAALQSFFQVGGIHGL
PYIPWDGVTGIPNPTWGGYCTHGSVLFPTWHRPYVSAFEQILWTRAQEVAATYTVDQAAW
KAAATTLRQPYWDWAVNSVPPDEVIAKQTVSITGHDGKKKDVANPLYHYTFHPIDPSFPT
PYSGWKTTLRQPTSLQPDATDNIARLRLVLKNAQSNIRSNTYNLLTRVTTWPAFSNHTVG
DGGSTSNSLEAIHDGIHVYVGGNGQMGDPAVAGFDPIFFLHHCNVDRLLSLWSALHHGVW
VTPGPSQRGTLTIPANSTVDTNTNLTPFYHTQTAFWASAGVPDTTKLGYTYPEFNGLDTS
NPAAVQKAIAAIVNKLYGSAVFGVQSALVQEPAAAAQQPVAAAAPSAPSADDHHPTIQHA
GHGYPRDWTARVEFKKFETGQSFSVLLFLGSVPEKPEEYITSPHFVGAHHAFVNSAASHC
QNCQNQAELVEEGFVHLSRGILQYGKLESLDAEVVEPYLTKDLHWRAVKADGITPVEIPS
LEVSIFSTPLTYPRGSAFPIAGNTNRHSGITHGRRGGSRELHPGNH
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcttcgtcatttctggtcctggtggaggtgctccaaaccgcctcgaaatcaga
acgttcgtccagcatgacaagtatttctcgctctacatccaagctctccagcttatgtat
acgaaagagtcgcaggccgctctccaatctttcttccaagtcgggggcattcacggcttg
ccgtatatcccttgggatggcgtgactggtatcccgaaccctacttggggtggatactgt
actcacggttcggttctcttccccacttggcatcgcccttatgtttccgcgtttgagcaa
attttgtggacccgcgcacaagaggttgccgcaacttacacagtcgatcaggcggcctgg
aaggcagctgcgactacgcttcgtcaaccttactgggattgggcagtcaactccgtacca
cctgatgaagtgatcgccaaacagacggtgtccatcactggtcatgacggaaagaaaaaa
gacgttgctaaccctctttatcactatacattccacccaatcgatccttctttccccaca
ccttacagtggctggaaaacgactctcaggcagcccacgagcttgcagcccgatgccacc
gataacattgcaaggctgagattggtcttgaagaatgcacagtccaatattcgctcaaac
acttacaatctgctgaccagagtcaccacttggcccgccttcagtaaccatacggttggc
gatggcggaagcaccagtaacagtctcgaagccattcacgatggcattcacgtctacgtc
ggaggtaacggacaaatgggcgatccagccgtcgcaggcttcgatcccatctttttcttg
catcactgcaacgttgacaggctgctctctctttggagcgcactccatcacggtgtttgg
gtcacaccaggtccttcccaacgtgggaccctcaccattcccgcgaactctaccgttgac
acgaacacgaacctgacgcctttctaccatacccaaaccgcgttctgggcctctgctggc
gttcccgacactacgaaactcggctacacgtaccctgagttcaacggcctcgatacatct
aaccctgcagccgttcagaaagccatcgccgctatcgtcaacaagctttacgggagcgca
gtgttcggcgttcaatccgcacttgttcaggagcccgccgcagctgctcagcaacccgtc
gcagccgctgcaccctccgcaccctctgcagacgatcatcacccaactattcagcacgcg
ggccacggctaccctcgggattggactgcgcgcgtcgagttcaagaaatttgagactggc
cagagcttctccgtcctgcttttcctgggttcggttcccgaaaaacccgaagaatacatc
accagcccccactttgtcggcgctcaccatgcgttcgtcaatagtgccgcaagtcactgc
cagaactgccaaaatcaagcggaattggtcgaggagggtttcgttcatctcagtcgcgga
attttgcaatacggaaaattggagtctttggacgcggaggttgttgagccttacctgacc
aaggatttgcactggagggctgttaaggccgacggtattacccctgttgaaatcccctct
ttggaggtcagcatcttctcgaccccattgacttacccacgtggttcagccttccccatc
gctgggaacactaatcgccacagcgggatcactcatggtcgtcgtggagggagtcgcgaa
ttgcaccctggcaatcattaa

DBGET integrated database retrieval system