KEGG   Laccaria bicolor: LACBIDRAFT_295156Help
Entry
LACBIDRAFT_295156 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LACBIDRAFT_295156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 227 aa AA seqDB search
MAWRCSGFSNAELISNLANHGIFHSDRVAAAMSAVDRANYVVDKSDAYDDSPQPIGHGAT
ISAPHMHACASEHLLPYLNPGSRVLDVGSGSGYLAAVLHHLVSPGGKVVGIDHIPALVDW
SVQNLKNDGLGGAIDKGEIVMVAGDGREGYASAGPYDAIHVGAAAANVPQSLIDQLASPG
RMFIPVGTFMQFIEQIDKDENGKLTRKKVMGVRYVPLTDREKQTDEL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgatgcagcggcttcagcaacgcagagctcatctccaacctcgccaaccac
ggcatattccactcagacagagtagcagccgcaatgtcagccgttgatcgcgccaactac
gtcgtcgataaatcagatgcatacgatgattcaccacaaccaatcgggcacggggcgacg
atcagtgctccccacatgcacgcatgcgcatcagagcacctccttccgtacctcaaccca
ggatcccgcgttctagacgtaggcagtggctcggggtacctcgccgccgtgctgcaccac
ctcgtctcaccaggtggtaaagtcgtcggcatcgaccacatccctgcattggtggattgg
tcggtccaaaacctgaagaacgacggactgggaggtgcgattgataaaggcgaaattgtg
atggtggctggggatggaagggaggggtatgcgagtgccggcccctatgacgcgatccac
gtcggcgcggcagcagctaacgtcccccaatctctcatcgaccagcttgcgagtccagga
cggatgttcatccctgtagggacttttatgcaattcatcgaacagatcgataaagacgag
aatgggaagttgacgaggaagaaggtgatgggtgttaggtatgtcccgttgacggatagg
gagaagcagacggatgagctctga

DBGET integrated database retrieval system