KEGG   Laccaria bicolor: LACBIDRAFT_295705Help
Entry
LACBIDRAFT_295705 CDS       T01044                                 

Definition
hypothetical protein
Organism
lbc  Laccaria bicolor
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1215 aa AA seqDB search
MNPPVLNPHDTDSTSTKAFTKGKSFKKDMAILSIAYTLQESSELKRLIQLIVVIRDNDSK
GQLTEVLETCARFSVQLASATTDAQRAETARAVTAFNKPDRSECFYPPFRTIAKLKTIQL
NGDSKSLDGLMDMIKGDIEGIKPSFVSDGEHGTSEKLSKVLDITIGTTISILTLVEEASS
LIPVPPSRTLGSIAEECEKLSRLNLLSRYLQQSAHMGDLEAIRRRLDVAIQLFQTENSVN
IKLDTEELNRKFDFASLNGLPSHPDYTRNEYLEKSRDDVIRDVSDWIANAPESVLWVHGA
AGLGKSTVAQELVHLLKSEDRLAGGIFLTNLTTESPKRVIQMISRQLGAMYPQAIANIAD
AARTLDGPHDGLRDYLTAYIFDPIRALGYPYQLVIVVDGLDEWGNYESFLAELVHIPSPS
PLKFVLTSRFNYSIERAVDKMLTRKYPLPPASQTVIESYFHQHLLLGNINWRGRKPDNDK
IHRLAARADGLLIWAATARSLVSNKFDTRYPHEILDQMLSSEEKMINQKDGSEDRQLERL
YRSAISTSFPTSRSQVILRKFLAATLVLQEALPIGDFAHLSGIPRPAAEEIHQRLAALPA
HGDPKTNLVSPATQRFHASFVEFITTESDDQAFQAISITEAHYVLASRCLEIVFVELLPS
FRGKTCAYAELRGVEPYAVKFWPLHFSSGTPRQQLAPPSGAVGMELISEEAMHRWATLFL
PCIAARFQDGHMSQALDDIQKSGLAYEIAIMIGNEDVTTLSYHIQCLEIATRLEPINMWT
WKALGFAYHRLHEQSQSNRDLDEVITAFRHGLEPAPHPDRAESLNRIATALHTRYKWWGT
SNNLDEAISLHREALLLRPVPHPDRAVSLNNLANALQTCFEERGASNNLDETISLRREAL
LLEPAPHPDRSMSLNNLANSLQTCFKQWGVSNDLDEAISLHQEALLLRPAPHPDHSMSLN
NLANALQTRFEQWGASNDLDDTISLHQEALLLRPAPHPDHSMSLNNLANALQTRFEQRGA
SNDLDDTISLHQEALLLRPAPHPDRFSSLNNLANALRNRFEQWGTSNDLDKAISLHQGAL
LLCPAPHPDHFSSLNNLANALQARFEQQGISNNLDEAISLHQEALLLLPAHHPQDSSLLR
NLAIALIIRFNEGNLLRDLTEAMSLYERLLDCPVDDPNRSWSLEHLLPELREWGALIGDH
GDIFGSTDAEGSSLT
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctccggtgctgaatcctcacgatacggattcaacatctaccaaagcattcacg
aaaggcaaatctttcaaaaaagatatggccattctctctatcgcgtataccctccaagaa
agttccgagctcaagaggctcatccagcttattgtcgtaatccgcgataatgactcgaaa
ggccagcttaccgaagttctcgagacctgcgctcggttcagcgttcaacttgcatctgcc
actaccgatgcccagcgtgcagaaaccgcgcgggcggtgacagcgtttaataaacctgat
cgttctgaatgtttctatccaccatttaggacaattgcgaagctcaaaactatccaactt
aatggcgacagcaaatccttggatggattgatggatatgataaagggagatattgagggg
atcaagccttcgttcgtgagcgatggcgaacacggaacttcggagaaactatccaaagtg
ttggatataaccatcgggacaaccatcagcatcctcaccctcgtagaggaagccagctct
ttaataccggtaccgccgtctcggactctcggaagcatagctgaagaatgtgagaaactt
agtcgactcaatctcctttcgcggtacttgcaacaaagtgctcacatgggtgacctcgaa
gctatcagaagaaggctggacgtcgcaatccaattgtttcagacggaaaattcggtcaat
ataaagctggataccgaggaactcaaccggaaatttgatttcgcatcactgaacggcttg
ccgagccatccagactatacacgcaacgaatatcttgagaaaagtcgagatgacgttata
cgggatgtttccgactggatagctaacgccccagagtctgtcctctgggtacatggtgcc
gctggcctaggtaaatcgactgtcgctcaggaattggtccaccttctcaaatcggaggac
cgccttgctgggggtatatttctcaccaatctgactacagagtcccccaagagggtcatc
cagatgatctccagacagctcggcgcgatgtatccgcaagccatcgctaacattgccgac
gctgcaaggacactcgatggcccgcacgacgggcttagggattatttaacggcatatatt
ttcgacccaattcgtgcgcttgggtacccttatcagcttgtcattgttgtggatggtctg
gatgaatggggaaattatgaatcattcctggcagaacttgtgcacattccgtcgccctct
cctttaaaatttgtcctgacaagtcgcttcaattactccattgaacgggctgtcgataaa
atgctaactcgcaaataccctcttcccccggcctcacagacggtcatcgagagttacttc
catcagcacctcttactaggcaatattaattggagagggcgcaagcccgacaatgacaaa
atccatcgattggcggctcgtgcagatggtctccttatctgggcagcaacggcacgatca
ttggtatcgaataaatttgacactcgatatccgcacgagatacttgaccaaatgctgtcg
tccgaagagaagatgatcaatcagaaagacggttcggaagacaggcagcttgagcgtcta
tatcgcagtgctatttcgacctctttcccaacttcacgcagtcaagtgatactcagaaag
ttcctggcagcaacattagttctccaggaagccctgccaattggtgatttcgcacatctc
tcaggcatacctaggcccgccgcagaggagattcaccagcggctggcagccttgccggcg
catggtgatccgaaaactaatcttgtatctccagcaacacaacgatttcacgcgtcgttc
gttgaattcatcaccacagagtctgatgaccaggcatttcaagctattagcattacagaa
gcgcactacgtattggcgagtagatgcctcgagattgtgtttgtcgagttactcccatct
tttcggggaaagacttgtgcttacgcagagcttcgtggtgtagagccatatgctgtcaaa
ttttggcctctgcacttctcaagtggaaccccacgtcaacaattggcaccacctagtggt
gcagtgggtatggaactgatatcggaggaagcgatgcatcgttgggctacactgtttcta
ccttgtattgcagccagattccaggatggccatatgtctcaggctcttgacgacatccaa
aagtctgggctggcttatgagattgccattatgattgggaacgaagatgtcaccacactg
tcatatcacattcagtgtctcgagattgccacacgacttgagccaattaatatgtggaca
tggaaggcattaggatttgcctatcacagattacatgaacaaagccagtctaacagagac
ttggacgaggtgattactgcatttcgtcatggtctggaaccagcacctcatccagatcgc
gccgaatcactcaatagaatcgccactgcccttcacactcgttataaatggtggggcact
tcaaacaaccttgatgaagcaatttccttgcaccgagaggcgcttcttcttcggccagta
cctcatccagatcgtgccgtgtcactaaataaccttgccaatgcccttcaaacttgtttt
gaagagcggggtgcttcaaacaaccttgatgaaacaatttctttgcgccgagaggcactt
cttcttgagccagcacctcatccagatcgctccatgtcactcaataatcttgccaattcc
cttcaaacttgttttaaacagtggggtgtttcaaacgaccttgacgaagcaatttccttg
caccaagaggcacttcttcttcggccggcacctcatccagatcactccatgtcactcaat
aaccttgccaatgcccttcaaactcgttttgaacagtggggtgcttcaaatgaccttgat
gacacaatttccttgcaccaagaggcacttcttcttcggccggcacctcatccagatcac
tccatgtcactcaataaccttgccaatgcccttcaaactcgttttgaacagcggggtgct
tcaaatgaccttgatgacacaatttccttgcaccaagaggcacttcttcttcgaccagca
cctcatccagatcgcttctcatcactcaataaccttgccaatgcccttcgaaatcgtttt
gaacagtggggcacttcaaacgaccttgacaaagcaatttccttgcaccaaggggcactt
cttctttgtccagcacctcatccagatcacttctcatcactcaataaccttgccaatgcc
cttcaagctcgttttgaacagcagggcatttcaaacaaccttgatgaagcgatttccttg
caccaagaggcacttcttcttctgccagcacatcatccacaagattccagtttactcaga
aaccttgctattgccctcataattcggttcaacgaaggcaacctcttacgtgatctcact
gaagcaatgtcattgtacgaacgacttcttgattgcccggttgacgatcccaatcgctct
tggtctttagagcacttgcttccggagttaagggagtggggtgcgctgataggtgaccat
ggggacatttttggaagcactgatgcagagggatcgtcattgacgtag

DBGET integrated database retrieval system