KEGG   Laccaria bicolor: LACBIDRAFT_297266Help
Entry
LACBIDRAFT_297266 CDS       T01044                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbc  Laccaria bicolor
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACBIDRAFT_297266
   01230 Biosynthesis of amino acids
    LACBIDRAFT_297266
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACBIDRAFT_297266
   00030 Pentose phosphate pathway
    LACBIDRAFT_297266
   00051 Fructose and mannose metabolism
    LACBIDRAFT_297266
   00052 Galactose metabolism
    LACBIDRAFT_297266
  Energy metabolism
   00680 Methane metabolism
    LACBIDRAFT_297266
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LACBIDRAFT_297266
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LACBIDRAFT_297266
Protein phosphatases and associated proteins [BR:lbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LACBIDRAFT_297266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 817 aa AA seqDB search
MKIAVLTSGGDSAGMNAVVRSVVKTGILKGCEMFVVREGYEGLVRGNADGLRVDPVIIHN
LEQIIQKPSLIQNDPDKNLLHNLRFGDGDLLKDGTSEWVGGRTLKGRYIVRVGWDDVRGW
FAEGGTLIGTARSKTFRTPEGRTAAAHNLIKEGIHALVVCGGDGSLTGADVFRSEWPQLV
ADLHSQGKITDEQRAAHTHLRIVGLVGSIDNDMCMTDTTIGAPTALQRICEAIDNINSTA
YSHSRAFVVEVMGRDCGWLALMAGIAGGADFIFIPERPPYKMPWEDEMCAKIHRHREVGK
RKTIVIVAEGAQDSDLNPIRAEYVKEVLTERLGLDTRVTTLGHTQRGGRPCATDRILPTL
QGVEAVEALLESTPETPSYMIGVHENKIARVPLMEAVALTKAVGQAVRDKDFDKAMELRG
PEFGEALEGFMATSSLYVESDKLPQEQRIRVGIIHMGAPAGGMNAATRAAVRYCLRQGHT
PLAVHNGFRGLLDDNVDELSWLGVDAWMARGGSELGTNRALPSIDIGGMASKFQEFNFQA
VLIIGGFEAFNALLLLEEGRKHYPAFHIPMVHLPATISNNVPMTEYSLGSDTSLNALVDA
CDAIKQSASASRDRVFVVETQGGKCGYLAAMGALAVGANIVYTPEDGINLDMLRRDVRFL
KTRYTLDPPGRSEGRLVIRSEASSSVYTTTFITKMLQEEGGALFDARSASLGHTLQGGIP
SPMDRARGVRLSLKCMAFLEQHHAVLQKQPAHKSRHASGSSAAVITIQGSSVTMVPVREM
VEHADMGNRRGKVAWWRGVKELEEELVGRSHFIGLRV
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgctgtcctcacatcgggtggcgacagcgcaggcatgaacgccgtcgtgcgc
tcagtcgttaaaactggtattctcaaaggatgcgagatgttcgtcgtgcgtgaaggctac
gaaggtctcgttcgcggaaatgccgatggcctgcgggtggaccccgtcatcatccacaac
ctcgaacaaatcattcaaaagccttctcttatccaaaatgatcccgataagaacctactg
cacaatttacgcttcggggacggggatttgttgaaagacggaacgagtgagtgggtgggt
ggaagaactctcaaaggaaggtacattgttagggttggatgggacgatgtcagaggctgg
tttgcagagggaggcacattgattggcacagccaggtcaaagactttcaggactcccgaa
ggccgaactgccgccgcccacaaccttatcaaagagggcatacatgcgctcgtcgtctgt
ggaggagatggctccctcacaggtgcagacgtcttcagatccgagtggcctcagctcgtc
gccgatctgcattcgcaaggcaagatcactgacgaacaacgggcagcccacacccatctc
cgtatcgtgggactggtgggatccatcgacaatgatatgtgcatgacagacacgaccatc
ggcgctcccactgctctccagcgtatctgcgaagccatcgacaacattaactcgaccgca
tacagccactcccgtgctttcgtcgtcgaagtgatgggcagggattgtggttggttggcg
ttgatggcgggcatcgccggtggcgctgactttatcttcattcctgaacgccctccctat
aaaatgccatgggaggacgagatgtgtgcaaagatccaccgtcatcgtgaagttgggaaa
cggaagaccatcgtcatcgtagctgagggggcgcaggactccgaccttaaccctatccgc
gctgagtatgtcaaggaagtgcttacagagaggcttgggctagatacccgtgtcaccacc
ctcggccatacccaacgaggaggcagaccttgcgcgactgatcgaattctgcctacgctt
cagggcgtcgaagccgtcgaagcattgctcgagtctacgcccgagactccctcgtatatg
attggtgtgcacgagaataagatcgcacgggtgccgttgatggaggcggtggctctaaca
aaggctgtcggacaggctgtcagggacaaggactttgacaaggctatggaattgagaggc
cctgagtttggggaagcattggaaggattcatggcaacgtcgtccttgtacgtagagtcg
gacaagctacctcaagaacagcggatacgtgtgggcatcatccatatgggagcgcccgct
ggcggtatgaatgcagcgacccgtgctgcggtgcgatactgcctccgacaaggacataca
ccactggctgtacacaatgggttccgtggattgttggacgacaacgttgacgagctgtca
tggctcggcgttgatgcgtggatggcgcgaggaggatctgaactcggtaccaatcgcgca
ttaccctccattgatattggggggatggcatcaaagttccaggagttcaatttccaagct
gttttgatcattggagggtttgaggcattcaatgctttgttgctgctcgaggaaggaagg
aagcattatcctgcattccacattccgatggttcaccttccggcgacgattagcaacaac
gttccgatgacggagtatagtctgggaagcgatacaagtttgaatgcactagtggatgca
tgcgatgcgattaagcagagtgcaagtgcgagccgtgaccgagtgttcgttgttgagacg
caaggcggcaagtgtgggtatcttgcagctatgggggcattggcggttggtgcaaatata
gtgtatacacccgaagacgggatcaatctagacatgctgaggagggacgtgcgattctta
aagacgaggtataccttggatcctccaggccggagtgaaggacgactggtaatcaggagc
gaagcgtcatcaagtgtatacacgacgacatttattacaaaaatgttgcaggaggaggga
ggagcattgttcgatgcgcgatctgcttcgcttgggcatacactgcaaggtggcatccca
tcgccaatggaccgagcgcggggagtacggctttcgctcaagtgcatggcgttcctggag
caacatcacgccgtcttgcaaaagcagccggcacacaagtcacgacatgcaagtgggtcg
tctgcggcggttattacgatccaagggagctctgtgacgatggttcctgtgcgggagatg
gttgagcatgcagatatgggtaaccgacgaggtaaagtagcgtggtggagaggtgtcaag
gaacttgaggaagagctcgttgggcgaagtcacttcattggcttgcgggtgtaa

DBGET integrated database retrieval system