KEGG   Laccaria bicolor: LACBIDRAFT_297266Help
Entry
LACBIDRAFT_297266 CDS       T01044                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbc  Laccaria bicolor
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACBIDRAFT_297266
   01230 Biosynthesis of amino acids
    LACBIDRAFT_297266
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACBIDRAFT_297266
   00030 Pentose phosphate pathway
    LACBIDRAFT_297266
   00051 Fructose and mannose metabolism
    LACBIDRAFT_297266
   00052 Galactose metabolism
    LACBIDRAFT_297266
  Energy metabolism
   00680 Methane metabolism
    LACBIDRAFT_297266
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LACBIDRAFT_297266
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LACBIDRAFT_297266
Protein phosphatases and associated proteins [BR:lbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LACBIDRAFT_297266
Messenger RNA biogenesis [BR:lbc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LACBIDRAFT_297266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 817 aa AA seqDB search
MKIAVLTSGGDSAGMNAVVRSVVKTGILKGCEMFVVREGYEGLVRGNADGLRVDPVIIHN
LEQIIQKPSLIQNDPDKNLLHNLRFGDGDLLKDGTSEWVGGRTLKGRYIVRVGWDDVRGW
FAEGGTLIGTARSKTFRTPEGRTAAAHNLIKEGIHALVVCGGDGSLTGADVFRSEWPQLV
ADLHSQGKITDEQRAAHTHLRIVGLVGSIDNDMCMTDTTIGAPTALQRICEAIDNINSTA
YSHSRAFVVEVMGRDCGWLALMAGIAGGADFIFIPERPPYKMPWEDEMCAKIHRHREVGK
RKTIVIVAEGAQDSDLNPIRAEYVKEVLTERLGLDTRVTTLGHTQRGGRPCATDRILPTL
QGVEAVEALLESTPETPSYMIGVHENKIARVPLMEAVALTKAVGQAVRDKDFDKAMELRG
PEFGEALEGFMATSSLYVESDKLPQEQRIRVGIIHMGAPAGGMNAATRAAVRYCLRQGHT
PLAVHNGFRGLLDDNVDELSWLGVDAWMARGGSELGTNRALPSIDIGGMASKFQEFNFQA
VLIIGGFEAFNALLLLEEGRKHYPAFHIPMVHLPATISNNVPMTEYSLGSDTSLNALVDA
CDAIKQSASASRDRVFVVETQGGKCGYLAAMGALAVGANIVYTPEDGINLDMLRRDVRFL
KTRYTLDPPGRSEGRLVIRSEASSSVYTTTFITKMLQEEGGALFDARSASLGHTLQGGIP
SPMDRARGVRLSLKCMAFLEQHHAVLQKQPAHKSRHASGSSAAVITIQGSSVTMVPVREM
VEHADMGNRRGKVAWWRGVKELEEELVGRSHFIGLRV
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgctgtcctcacatcgggtggcgacagcgcaggcatgaacgccgtcgtgcgc
tcagtcgttaaaactggtattctcaaaggatgcgagatgttcgtcgtgcgtgaaggctac
gaaggtctcgttcgcggaaatgccgatggcctgcgggtggaccccgtcatcatccacaac
ctcgaacaaatcattcaaaagccttctcttatccaaaatgatcccgataagaacctactg
cacaatttacgcttcggggacggggatttgttgaaagacggaacgagtgagtgggtgggt
ggaagaactctcaaaggaaggtacattgttagggttggatgggacgatgtcagaggctgg
tttgcagagggaggcacattgattggcacagccaggtcaaagactttcaggactcccgaa
ggccgaactgccgccgcccacaaccttatcaaagagggcatacatgcgctcgtcgtctgt
ggaggagatggctccctcacaggtgcagacgtcttcagatccgagtggcctcagctcgtc
gccgatctgcattcgcaaggcaagatcactgacgaacaacgggcagcccacacccatctc
cgtatcgtgggactggtgggatccatcgacaatgatatgtgcatgacagacacgaccatc
ggcgctcccactgctctccagcgtatctgcgaagccatcgacaacattaactcgaccgca
tacagccactcccgtgctttcgtcgtcgaagtgatgggcagggattgtggttggttggcg
ttgatggcgggcatcgccggtggcgctgactttatcttcattcctgaacgccctccctat
aaaatgccatgggaggacgagatgtgtgcaaagatccaccgtcatcgtgaagttgggaaa
cggaagaccatcgtcatcgtagctgagggggcgcaggactccgaccttaaccctatccgc
gctgagtatgtcaaggaagtgcttacagagaggcttgggctagatacccgtgtcaccacc
ctcggccatacccaacgaggaggcagaccttgcgcgactgatcgaattctgcctacgctt
cagggcgtcgaagccgtcgaagcattgctcgagtctacgcccgagactccctcgtatatg
attggtgtgcacgagaataagatcgcacgggtgccgttgatggaggcggtggctctaaca
aaggctgtcggacaggctgtcagggacaaggactttgacaaggctatggaattgagaggc
cctgagtttggggaagcattggaaggattcatggcaacgtcgtccttgtacgtagagtcg
gacaagctacctcaagaacagcggatacgtgtgggcatcatccatatgggagcgcccgct
ggcggtatgaatgcagcgacccgtgctgcggtgcgatactgcctccgacaaggacataca
ccactggctgtacacaatgggttccgtggattgttggacgacaacgttgacgagctgtca
tggctcggcgttgatgcgtggatggcgcgaggaggatctgaactcggtaccaatcgcgca
ttaccctccattgatattggggggatggcatcaaagttccaggagttcaatttccaagct
gttttgatcattggagggtttgaggcattcaatgctttgttgctgctcgaggaaggaagg
aagcattatcctgcattccacattccgatggttcaccttccggcgacgattagcaacaac
gttccgatgacggagtatagtctgggaagcgatacaagtttgaatgcactagtggatgca
tgcgatgcgattaagcagagtgcaagtgcgagccgtgaccgagtgttcgttgttgagacg
caaggcggcaagtgtgggtatcttgcagctatgggggcattggcggttggtgcaaatata
gtgtatacacccgaagacgggatcaatctagacatgctgaggagggacgtgcgattctta
aagacgaggtataccttggatcctccaggccggagtgaaggacgactggtaatcaggagc
gaagcgtcatcaagtgtatacacgacgacatttattacaaaaatgttgcaggaggaggga
ggagcattgttcgatgcgcgatctgcttcgcttgggcatacactgcaaggtggcatccca
tcgccaatggaccgagcgcggggagtacggctttcgctcaagtgcatggcgttcctggag
caacatcacgccgtcttgcaaaagcagccggcacacaagtcacgacatgcaagtgggtcg
tctgcggcggttattacgatccaagggagctctgtgacgatggttcctgtgcgggagatg
gttgagcatgcagatatgggtaaccgacgaggtaaagtagcgtggtggagaggtgtcaag
gaacttgaggaagagctcgttgggcgaagtcacttcattggcttgcgggtgtaa

DBGET integrated database retrieval system