KEGG   Laccaria bicolor: LACBIDRAFT_297786Help
Entry
LACBIDRAFT_297786 CDS       T01044                                 

Definition
glycoside hydrolase family 27 protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbc  Laccaria bicolor
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LACBIDRAFT_297786
  Lipid metabolism
   00561 Glycerolipid metabolism
    LACBIDRAFT_297786
   00600 Sphingolipid metabolism
    LACBIDRAFT_297786
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    LACBIDRAFT_297786
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LACBIDRAFT_297786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 438 aa AA seqDB search
MSALTLAFAGSLAYCLLSRKENAVTVQENGVGRLPFMGYNTWNAYHCDIDESIILETARL
MKALGLSDAGYDHVNIDDCYSERNRSASGDIVANKQTFPSGMNSLTNKIHKLGLKAGIYS
DSGWFTCQLYPGSYLNEERDIKTFQDWGFDLLKYDNCAVPFDEVIKEGIVGKYTRMSNAI
AKLSKESGKPPILFSLCEWGREEPWLWARRLGQSWRTTGDIEPNWNAIASILNENSFYSW
ASDFYGHNDMDILEVGNGDLTFEESKSHFTAWAFMKSPLLVGTELSKVTQQTLDILKNHE
IIAINQDPVVGTAITPFRWGINPDWTHNRTHPAQYWSGESQNGTIFMLLNVLNEPADLFF
SLTESPWIRAGRQYAVRDLWSHTDNGTAVRNLTVHNVPPHGVVALLLKDAGDEPSGTQPP
CARPEWCMDEDGRRADYD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaaccctagcattcgccgggtcccttgcgtattgtttgctcagccggaaa
gaaaatgcggttaccgtccaagaaaacggagttggtcgactaccatttatgggatacaat
acgtggaacgcttatcactgcgatatcgacgagtccattatcctcgagacagctcgcctc
atgaaggctcttggactctcggatgctggttatgaccacgttaacattgatgattgttat
tctgagaggaaccggagtgcatcgggcgatatcgtcgccaataaacaaacttttccttct
gggatgaatagtctgacaaacaaaattcacaaacttgggctgaaggcagggatatatagc
gattctgggtggttcacttgccaactctaccctggttcttacctgaacgaagaaagagat
atcaagacttttcaagattgggggttcgacctcttgaaatatgataattgtgctgtcccc
tttgacgaggttatcaaagagggcatcgtgggcaaatacacccgcatgtcgaatgcgatt
gcaaaactcagcaaagaatctggaaagccgcccattcttttctctttatgcgaatgggga
cgtgaagaaccttggctttgggctcgacgtcttggacaaagctggaggaccactggcgat
atagaacccaactggaatgcaatcgcgagcattttaaatgagaattcattctattcttgg
gcctccgacttctatggccacaatgacatggatattcttgaagtgggcaatggtgatctc
acatttgaagaatctaaatcgcacttcaccgcttgggcttttatgaagtctcctcttcta
gttggaacggaactttcaaaagtgactcagcagactctcgatatcctcaaaaaccacgaa
atcatcgctattaatcaagacccagttgtgggcacagcgatcacgccttttagatggggt
atcaaccctgactggacacacaatcgaacccaccctgcgcaatactggagcggtgaaagt
caaaacggaactattttcatgctcttgaatgttttgaacgagcccgctgacttgtttttc
tccttgacggaatctccctggatacgtgctgggaggcaatatgcagttcgggatctttgg
agtcatacagacaatggtacggccgtccgaaaccttactgtacacaatgtccctccccat
ggcgtggttgcgttgctactcaaggatgccggggatgagccaagtggaacgcagccacct
tgtgctaggcctgaatggtgcatggacgaagatggcagacgagctgattatgactga

DBGET integrated database retrieval system