KEGG   Laccaria bicolor: LACBIDRAFT_300664Help
Entry
LACBIDRAFT_300664 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lbc  Laccaria bicolor
Pathway
lbc00010  Glycolysis / Gluconeogenesis
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACBIDRAFT_300664
Enzymes [BR:lbc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     LACBIDRAFT_300664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 6068770
NCBI-ProteinID: XP_001873803
JGI: 300664
UniProt: B0CPU4
AA seq 300 aa AA seqDB search
MPVSNLHDRVVLQHPKGSTVEVLFYGATVISWRAADIGASEVKERLFVSSKAFLDGSKPV
RGGIPVVFPCFGAPTHPEHSKLGQHGFARSEVWSLDSVAMDNDAGVSVRLTLEQNHKITP
IFPKPFHLTYVVTLAEHQLSTDLHVKNASSTAGDSLEFQALLHNYIRAPADQVQVAPLQH
LQYYDKTETSDQARALPKVEARAAVDVIRYTDSVYQDAPQNYKVAWPEGGLKIRSVNLKD
VVVWNPQEEGRKIADMEEDGWKHYICVEPGFVRGFVKLEAGKTWIGQQVISVLGPVESAL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcagcaatttacacgatagagttgtccttcagcatcccaagggatcgactgtc
gaggtcctgttctatggtgccacagtcatttcatggagagcggcagatatcggcgcttct
gaggttaaggaacgacttttcgtgtcctcgaaggcattcttagatggtagcaaacctgtc
cgtggtggaataccggttgtcttcccttgtttcggtgctcctacacatccagagcactca
aagcttggacaacacggctttgcacgaagcgaggtgtggtccttggactctgtggcaatg
gacaatgacgctggcgtttctgtgcgactgaccctcgaacaaaatcacaaaatcactcct
atctttcctaagcccttccatctcacttatgtcgtgacattggcagaacatcaactcagc
accgatctccatgtcaagaatgcatccagcacagcaggagattccctcgagttccaggcc
cttctccataactacatccgtgcccccgccgatcaagttcaagttgctccccttcaacat
ttgcaatactacgataaaactgagaccagcgatcaagcacgagccttgcccaaagtggag
gccagagctgcagtggatgtcattcgctatacagattcggtctatcaagatgctccacaa
aattacaaggtggcatggccggaggggggtctcaaaatcagatcggtcaatttgaaagat
gtggttgtttggaatccgcaggaagaaggccgaaaaatagctgatatggaggaagatgga
tggaaacactacatatgtgttgagccaggcttcgtgcgagggtttgtgaaacttgaagca
gggaagacatggattggacagcaggttatttcggtgctaggaccagtcgaatctgcgttg
tga

DBGET integrated database retrieval system