KEGG   Laccaria bicolor: LACBIDRAFT_300832Help
Entry
LACBIDRAFT_300832 CDS       T01044                                 

Gene name
MCR1.1
Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lbc  Laccaria bicolor
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lbc00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 308 aa AA seqDB search
MSGRVEVENIPGQVANLLKNVTAGDLLNVASSPAFLVAAAAIVIAAAFYSKVFNSTRPKP
LDPSIWKEFPLQKKNQVSPNTAIYTFKLPHAEDVLGLPIGQHISVSADINGKNIVRSYTP
ISRQNARGRFELIIKTYEKGNISRHVASLKIGDTLRVKGPKGNFKYTPGLTAHLGMIAGG
TGLAPMIQIVRAILQNPPDRTNITLIYANVNEEDILLRAELDALAMGYESRFNLFYVLNN
PPSGWTGGVGFVTKEHIKDLLPNPNESNSKILICGPPPMVTAMKKNLEEIKYPVPNTISK
LDDKVFVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtcgcgtagaggtcgagaatattccgggtcaggtcgccaacttgctcaaaaac
gtcaccgctggtgatttgctcaacgttgcttcctctcctgccttccttgtcgctgctgct
gcaattgtcattgccgccgcgttctactccaaggtcttcaactctactcgcccaaagcct
cttgatccaagcatctggaaagaatttcctcttcaaaaaaaaaaccaggtgtccccaaac
actgccatctatacattcaagttgcctcacgctgaagacgtcctcggtcttcctattggc
cagcacatttccgtctctgcagatatcaacggcaaaaatatcgttcgtagctacactccc
atcagccgacaaaacgcacgcggtcgtttcgaactcattatcaagacctacgaaaagggc
aacatttcacgtcatgttgcatccctcaagattggtgacacacttcgcgtcaaaggtccc
aaaggcaatttcaagtacacccccggtcttactgctcaccttggcatgattgctggtggt
actggcttagctcccatgatccagatcgtccgtgctattcttcaaaaccctcccgaccgc
accaacatcaccctcatctacgccaacgtcaacgaggaggatatcctgctgagagctgaa
ctcgatgccctagccatgggctacgaatctagattcaatctcttctacgtcctcaacaac
cccccatcagggtggacaggcggcgttggtttcgtcacaaaggaacacatcaaagatctc
cttcccaaccccaacgagtccaacagcaagattctgatctgcggtccacccccaatggta
actgcaatgaagaaaaacctggaagagatcaaataccccgtgcccaataccatcagcaaa
cttgacgacaaggtctttgtgttctag

DBGET integrated database retrieval system