KEGG   Laccaria bicolor: LACBIDRAFT_302750Help
Entry
LACBIDRAFT_302750 CDS       T01044                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
lbc  Laccaria bicolor
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LACBIDRAFT_302750
Enzymes [BR:lbc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     LACBIDRAFT_302750
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     LACBIDRAFT_302750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1594 aa AA seqDB search
MTKNRRSAYGKSKPSVHIPKSGSKSGSRSPSASSSPSPLTPKTPADEAIEFFQAQAQSGD
DPIRVYELRLEPDGGPHRDLSYIRLPPAYTPYILRVSLQAGNPAAKNGVFKTNFPINGGV
FGRENYAKRKLPQDFSKPVQVDLPISHAGAFVYWVEYDGHNGERVKGRSGYFNIDPILKI
KARSPILNDQQQVLPQGEGAVVLNDYIHLPLDGLSILTLVSKWMGPLEGWAKYFDEAKER
GYTMVHYTPLQERGSSDSPYSIRDQMKYDSSLFGTKLTSSAGRTKVEDTLKLAREKYGLL
SLTDVVLNHTANDSEWLVDHPEAGFSPANTPHLTPALELDTAILEFSSSLAARGLPTIVT
SGEDVEKLISAFHDVIQGLDLWQYYVLDPARETESVKAALESKVDVPWAGPNVSGKSAAE
LAEVLRAEKKVKGLGGLASRFGVKVDSTIAAGIIKAALGASQDVDAMTEAWKNVVDVINV
PLYEEWKEDQRVALDNMKNRVKYTRLDPHGPKLGEISETNPLVEPYFTRLEKPSPSADPS
LYSLANNGWIWDADPLQNFALLPSKAYLRREVIVWGDCVKLRYGSSPTDNPWLWSYMTSY
VTSLAHTFDGFRIDNCHSTPLEVGTHMLDAARVVRPDLYVCAELFTGSEEMDLVFVRELG
INSLIRESGNAWDPKELSRLLYRHGLGKPIGSMDNACMVTREELPSPTGKGPTRNAVVTP
LNGALPHALLYDQTHDNESPLDKRSAEDALSTGALVTFSYSAIGSVKGFDDLYPKLLNLV
QEKRTYEPTGIGEKSGISKVKRVLNELHLEMVVDGYEEGHVHQENDYIVLHRVQPKTQKG
YLLVAHTAFSKGSKDRGFIAPIKLRRTRAKFILGASIDILSYDGPKDSQILKGLPAKLVE
TESVVAREGVDHEGLFAEIVVPQHFPPGSIMLFETQLQAHDASLEAFCASGVQEAFSDIN
LVDLNVILHRADVEERDATGGAFGAYEVPNLGKMVYCGLEGWMHPLKHIMRYNDLGHPLC
GHLREGSWALDYVHQRLSYQMAEFPNLAKPALWLKERFDHVKATVPNFMRPKFFALVISE
AYKAARRAGMEQCSEFVASGHGFTQDLAMCGVQMLGLVKSASLNPGVATPSLAAGLPHFA
TNWARCWGRDVFISLRGLFLTTGNFEEARKHILAFASTLKHGLIPNLLDSVRNPRYNSRD
SPWWMLQNIQDYVNSAPEGIAILSEPVKRRFPKDDTWVPWDDPRAYAYSTSLAEIVQEII
QRHVDGIYFREYNAGPQLDMQMKDEGFNIDIQVDWETGFILGGNQHNCGTWMDKMGESEK
AGTKGVPGTPRDGAPVEITGLLKSTLRWLNELSGCGKFPFKGVEATIKGRQRLVTYKEWS
DLLQSSFEKFYYVPLESSDDAKYAINSKLVNRRGIYKDVYGSGPGHEWADYQFRPNFPIA
MTVAPELFDERHAIGALQLVDKVLRGPLGIKTLDPNDLQYRPVYDNSNDSSDPAIAKGLN
YHNGPEWGWPLGYFLRAYLFFDTLVGSGKDDRNQTLHHLHQMLVKARDYVQRDAWAGLPE
LTNENGGYCSDSCNTQAWSASTLLDFLETVHRME
NT seq 4785 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaccgcagaagcgcctacggtaaatcaaagccctcagtccacatcccaaag
tcgggctcgaaatcaggttctcgctcgccctctgcttccagctctccctcccctcttact
ccaaagacacccgctgacgaagccatcgagttcttccaggcgcaagctcagtcgggggac
gacccaatacgcgtctatgaacttcgacttgagcctgatggcgggccccatagggacctc
tcatacatccgtctcccaccagcatatacgccgtatatcttacgcgtttcactccaagcg
ggcaatccagcagcgaaaaacggtgtcttcaagaccaacttccccatcaatggtggggtg
tttggcagagaaaattatgcaaagagaaagttaccgcaagacttttcgaaaccagtacag
gttgacctacccatctcgcacgctggcgcttttgtctactgggtcgaatatgatggacat
aacggcgagcgtgtcaaaggacgctctgggtattttaatatcgacccgattctcaagatc
aaggcgagatcaccgatactgaatgatcaacagcaagtcctaccccaaggcgaaggtgcc
gtggttctgaacgactacattcacctgccgttggacggattgtccatcctcactcttgtg
tcaaagtggatggggcccttggaagggtgggcgaaatattttgatgaggcgaaagagcga
ggctacaccatggtgcactacacgcctttgcaagagaggggaagcagtgacagcccatat
tcgatccgcgatcaaatgaagtacgactctagcctttttggaaccaagttgaccagtagt
gcggggagaacaaaggtggaagataccctgaagcttgcgcgagagaaatacggactctta
agcttgacggatgtagtcctcaatcacaccgcaaatgacagcgagtggctggtggatcac
cctgaagcaggattcagtcccgcaaatacgccccatctcactcccgcacttgaacttgac
acggcaatccttgaattttccagctcactggctgccaggggtcttcccaccatcgtcact
tcaggggaagacgttgaaaaacttatctcagcctttcacgatgttattcaaggtctggac
ctctggcaatactatgttcttgacccagctcgggagaccgaatcagtaaaagcggctctt
gaatcaaaagtggatgtaccatgggctggtccaaatgtaagtgggaaaagtgcggcagaa
ttggcggaagtgttgagggccgagaaaaaggtgaaggggttaggtgggttagcatcacgc
tttggggtgaaagtcgacagcactatcgccgctggtattatcaaggccgctctcggggca
tcgcaggacgttgatgcgatgacggaagcctggaagaatgttgtcgacgtgatcaacgtc
ccattgtacgaggaatggaaggaggaccagagggttgcgttggacaacatgaagaaccga
gtgaaatacaccaggctcgatccgcatggaccaaaattgggcgaaatctctgagacaaat
ccgcttgtagagccatatttcacgcgtctggagaaaccatcacccagtgccgatcctagt
ttgtactcgctagcgaataacggctggatctgggatgcagatcctctgcagaatttcgcc
cttcttccatccaaagcatatctccggcgggaggttatcgtctggggtgattgcgtcaag
ttgcgctacgggtcatcgccaaccgacaatccatggctttggtcgtacatgacatcctac
gttacatcgctggcacatactttcgacggtttcagaattgacaattgtcactcaactccc
cttgaagttggcacgcacatgcttgatgcggcgcgtgttgtgcgtcccgacctctacgtc
tgtgcggaacttttcactggaagcgaggagatggacttggttttcgtacgtgagctaggc
atcaatagtttgattagggagagcggcaacgcgtgggatcccaaggagctgtcaagactg
ctgtaccgccacggcttaggaaagccgattggatctatggataatgcctgcatggtgaca
cgggaggagttgcccagcccgactggaaagggacccacgaggaatgccgtggtgacgccg
ctcaatggagcgctcccgcacgccttgctgtacgatcaaacgcacgacaatgagtcacct
ttggacaagcggtccgccgaagacgcgttgtccacgggcgcactcgtgacttttagttac
agcgcaatcggcagtgtgaaaggatttgatgacctatacccaaagttgctgaacttggta
caagagaagaggacatatgaacccactggtattggggaaaagagtggaatttccaaagtg
aaaagggttctaaacgaacttcatttggagatggtggtggatgggtacgaggaaggtcac
gtccatcaggaaaatgactatattgtcctccatcgcgttcagcccaagacccagaagggg
tatttacttgtcgcacacacagcattctcaaagggatcgaaggatcgtggattcatcgcc
ccgatcaagctacgccgaacgagggcaaaatttattcttggggcgagcatcgacattctg
tcctatgacggacctaaggattctcagattctcaaaggtctgccggcaaagctagttgaa
acggagagtgtggttgcacgagaaggcgttgatcacgaagggctttttgctgaaatcgtt
gttccccaacattttcctcctggcagtatcatgctcttcgagacccaacttcaggctcac
gatgcatcgcttgaggccttctgtgcatctggtgtccaagaagcattcagcgacatcaac
ttggtagatctgaatgtcatcttgcaccgtgcagatgtcgaagagagggacgcgactgga
ggtgcctttggcgcatatgaggtgcccaacttgggtaagatggtatactgcggtttggag
ggttggatgcatccgctgaagcatatcatgcggtataacgacttgggacaccccctgtgc
ggtcacttgagagagggcagttgggcactcgattacgtccaccaacgtttgagctatcaa
atggcggaattcccaaatctagcgaaacccgcactatggttgaaggaaaggttcgatcac
gtcaaagcgaccgttccgaatttcatgcggcccaagttcttcgcgctggttatctcagaa
gcatacaaggctgctcgcagggcagggatggaacaatgctctgaatttgtagcctcaggg
catgggttcactcaggatttggccatgtgtggcgtgcagatgcttggtctcgtaaagtca
gcttccctgaatcctggcgtcgcaaccccgtctctggctgctggtttgccacatttcgcc
acgaattgggcacggtgttggggtcgcgacgttttcatctcgttgagagggctcttcctg
acgactggaaactttgaagaggccaggaaacacatcctcgcgtttgcgtcgaccctgaaa
catggtttaattccgaatttattggattcagtgcgaaatccaaggtataattcgcgtgac
tcgccatggtggatgcttcagaatatacaggactacgtgaatagcgcgcccgaaggaatt
gccattctttcagaacctgtgaaacgtcggttccccaaagacgatacgtgggttccctgg
gacgacccgcgtgcatatgcttactcgacctcgctggccgagattgtccaagaaattatt
caacgtcatgtggatggaatatatttccgtgaatataatgcgggtcctcagcttgatatg
caaatgaaggatgaagggttcaacattgatatccaggtggattgggagacggggttcatc
cttggcggaaatcagcacaactgtggaacttggatggataaaatgggagagtccgagaag
gctgggaccaagggagtgcctgggacacccagagacggcgccccagtagaaataactgga
ttattgaagagcacactgcggtggttaaacgagttatctgggtgtgggaagttccctttc
aagggggtggaagcgaccatcaaaggtcgccagaggttagtgacatacaaggagtggtct
gatcttctccaatcgtcgtttgaaaaattttattatgttcctcttgaatcatccgatgac
gcgaaatatgcaatcaactcgaaactggtcaaccgacgagggatatacaaggatgtttac
ggatcagggcctgggcatgaatgggcagattatcagttccgacccaattttccgattgcg
atgaccgtagcgcctgagctatttgatgaacgccacgcaattggtgcgctgcagcttgtg
gacaaagtgctgcggggcccccttggtataaagacgctggatccaaacgacttgcaatat
cgaccggtgtacgacaatagcaatgattcaagtgacccagctattgccaagggactgaac
tatcataatggcccggagtggggttggcctttaggttacttcttgcgagcgtatctcttt
ttcgacacattggtaggttccggaaaggacgatcgcaaccagacgctccatcatctccac
cagatgttggtgaaggctcgagattatgttcagagagatgcatgggctgggctccccgag
ctgacgaacgagaatggtggatattgttcggattcgtgcaatacgcaggcgtggagtgcg
agtacgttgttggactttttggagactgtgcatagaatggaatga

DBGET integrated database retrieval system