KEGG   Laccaria bicolor: LACBIDRAFT_305002Help
Entry
LACBIDRAFT_305002 CDS       T01044                                 

Gene name
LbPDI2
Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lbc  Laccaria bicolor
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LACBIDRAFT_305002 (LbPDI2)
Enzymes [BR:lbc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LACBIDRAFT_305002 (LbPDI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 417 aa AA seqDB search
MLSTPLLTLALALTPSLVSAAIFPADSLVKMLDAKSFKKALKANQTSMVAFVAPWCGHCQ
RMVPEYSKAALGLHPLVPVYAVNCDAEKNKRLCAEQGVTGFPTVKLFPRGNALAPMVYDS
GERTATGFYYWATRRIPKHFAKLYHEYEVKPWIEKNTSKHRALLLTKDKKVPLLWQVLAN
KYAGQLEMGTHRDKEGKTSVSLGFEAGGKKGSKVLIYPVGSNTPVRYEGIQKLESLSKFF
DSVLDGTADLKIAVEEAKKEEYVPPTTEELEIQRKQEAQRIALLHGGFTELIDFEKAILE
GGANYHETAGYGGMMGGVPEHLKKAEATASETTLATAPTITGIVDDVNPTSLSGQGDADA
KKAADVKKILDEAMEEAAQARKTTAAEPVKAEPTLAQEADQVVLEEPASTPRPTDEL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctacgccgctgctcacgctcgccttggcgctgacgccgtccctggtgtcagct
gccatattccctgcagattcgctggtcaagatgttggacgcaaagtcgttcaagaaggcg
ttgaaggccaaccaaactagtatggtggcattcgtcgcgccttggtgtgggcactgtcag
aggatggtaccggagtacagtaaagccgcgctagggcttcatcctcttgttccggtgtat
gctgttaactgcgacgcggagaaaaacaagcgattgtgtgctgaacagggagtcactgga
tttcctacagtgaaactctttccccgtggcaatgcactagcaccgatggtctatgattca
ggtgaaaggactgctaccggcttctactattgggccacgcgtcggattccgaagcatttc
gccaaattgtaccacgaatacgaagttaaaccttggattgagaaaaacacatccaaacac
cgcgctttgttactgacgaaggataaaaaggttcctttgttgtggcaagtcctcgcaaac
aagtacgcggggcaattggaaatgggcacgcatcgggataaggagggcaagacttctgtg
agtctgggtttcgaggctggagggaagaagggaagcaaggttttgatataccccgttgga
tccaacaccccagtccgatacgaaggcatccagaaactcgaatctctgtctaagttcttt
gactcggttctagatggcaccgcagacctgaagatcgccgtcgaggaagcaaagaaggag
gaatatgttccgccaacaaccgaagagctcgaaattcagcgaaagcaagaggcgcagcgg
atagcgttgctgcacggcggtttcacggagctaattgactttgagaaggccattttggag
ggtggcgcgaattatcacgaaacggctggctacggaggtatgatgggtggtgtgccagag
catttgaagaaggctgaagcaaccgcttcggaaacaacgttggcaacggcgccaacaatc
actgggatcgttgacgacgtcaatcctacctcgttgagcggccagggcgatgcggacgcg
aagaaggcggcggatgtgaagaagattttggatgaagcgatggaggaggctgcacaagca
cggaaaaccacggctgctgagccagtgaaggctgagcctaccctagctcaggaggcagat
caagtcgttttggaggagccagcctcaactccccgcccgacggatgagctgtaa

DBGET integrated database retrieval system