KEGG   Laccaria bicolor: LACBIDRAFT_305169Help
Entry
LACBIDRAFT_305169 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
lbc  Laccaria bicolor
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LACBIDRAFT_305169
   00240 Pyrimidine metabolism
    LACBIDRAFT_305169
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LACBIDRAFT_305169
   03410 Base excision repair
    LACBIDRAFT_305169
   03420 Nucleotide excision repair
    LACBIDRAFT_305169
   03430 Mismatch repair
    LACBIDRAFT_305169
   03440 Homologous recombination
    LACBIDRAFT_305169
DNA repair and recombination proteins [BR:lbc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      LACBIDRAFT_305169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 222 aa AA seqDB search
MAPAKKTTSLRQGTLSFASSKPTAATTSAKLKNTNSVTVAAPTSSKKRAVESSSEDSDEI
ESSSTSPPPAKAEGKVHTSAQKSTRQTSKSSAETRAEPVPTSVFKSKDATENSRAGKAVE
EASRPELNPKDRKYNKHYTLVRDKMGHMLPIHGEGQTKIHEILRVFDLSDQYGPCVGVTR
IERWERASMLGLNPPQEVYDILSTKQGATESQYIENVFYDQV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcacctgctaagaaaacaacctccttaaggcaaggaacactttcctttgcctcaagc
aaaccaacggcagccacaacaagcgcaaaattgaagaatacaaactctgtcaccgtcgcc
gccccaacatcctccaaaaaacgagctgttgaaagcagcagcgaagattctgatgaaatt
gagagctcatctacctctcctcctcccgctaaggctgaggggaaggttcatacatctgcc
cagaaaagtacgaggcagacctcgaagtcttcagccgaaaccagggccgagcctgtgcca
acgagtgtgttcaagtcaaaagacgctacggagaactcaagggctgggaaggctgtggaa
gaagcctcaaggccagagttgaatccgaaggataggaagtacaacaagcactatacgctt
gttcgagacaagatgggacatatgctaccaatacatggtgaaggccagaccaagattcat
gagattcttcgcgttttcgacctttcagaccaatatggaccttgcgtaggtgtcactcga
attgaacgttgggagagggcgtcgatgttaggtctcaatccaccccaagaggtctacgac
attctttctactaaacagggtgcaacggaatcacaatatatagaaaacgttttttatgac
caagtctga

DBGET integrated database retrieval system