KEGG   Laccaria bicolor: LACBIDRAFT_305245Help
Entry
LACBIDRAFT_305245 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 540 aa AA seqDB search
MAASGCPHIAKHLGDVSTTGDTDFIQKYKTVVSWNVRYAQSVRNPAKRRKVFAPMCGVCD
LALSRPFACLHCDFAGCWLEGHALGHLRDAGHNFCADTKTGSIFCAQCQDFIYHPKVDEI
YLAAVVMTEEQQTKFQVSKKLREPYQIWVPEAKDILALKNSVPIPCQARRGLLNLGQTCF
LNVVLQSFAHNPLLRNYFLSDKHNSKQCKTETCTCCEMDKLFTEIYSEDPNPYGPITFLA
TTWRASAELSGYAQQDAHEFFISALNQIHSTSRGSTEVSCNCIIHSTFAGQLQSDVKCER
CGNITNTIDPMLDISLELKGKGGEVAPGDTLAACLRRFTQFEKLGPKEYTCSKCAKISHE
ASKRLSIRTLPPVLSFQFKRFEHKTNDKSSARKIDAQVRFPASINMAPYTTLVIKDMEGA
NANDARYTCPAPEVMYEYDLFAVINHEGQIDTGHYTNYACFQDEWYKFDDDKVTPSTLGA
CLASAAYMCFYVKRHLDYKPNIKPSYVQAHEAEAVREKELEREREAARIKDVEDALLATV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttctggatgccctcacattgctaaacacctcggagacgtcagcaccaccgga
gacaccgatttcattcagaaatacaagacagttgtatcctggaacgtacggtacgctcag
agtgtcagaaaccctgcaaaacgaagaaaggtgtttgcgccgatgtgtggcgtatgcgat
ctcgctctttcccgtccattcgcatgcttacattgcgattttgctggttgctggctggag
ggacatgcgctaggtcacctgcgtgatgccggtcacaatttttgtgccgatacaaagaca
gggtctatattctgtgcccagtgccaagattttatctaccacccgaaagttgatgagatt
tacctcgctgctgtcgtgatgactgaagagcagcaaacaaaatttcaagtatcaaaaaaa
cttcgggaaccgtaccaaatttgggttccagaagcaaaggacatcctcgcgctaaagaat
tcggtcccgattccgtgtcaagcccgtcgaggtctactaaatctcgggcaaacctgtttc
ctaaatgtcgtgttgcagtcctttgcgcacaacccccttcttcggaactatttcctgagc
gataaacataattctaaacaatgcaagaccgaaacgtgcacatgctgcgaaatggataaa
ctctttactgagatatactcggaagaccccaatccgtatggacccatcaccttcctggcg
accacctggcgcgcatccgccgaactctccggctacgcccaacaagatgcacacgaattc
ttcatatccgcgctgaaccaaattcactcgacttctcgcggttcaacagaagtgtcttgt
aattgcatcattcactcaacctttgcgggccaactgcagagtgatgtgaagtgcgaacga
tgtggcaatataacgaacactatcgatcccatgcttgacatcagcctggagttgaaaggg
aaaggtggggaagttgctcctggcgataccctggccgcttgtttacggcgattcacgcaa
tttgaaaagctgggtccaaaagaatacacatgcagtaaatgcgccaagatctctcacgaa
gccagcaaacgtctaagtattcggacactacctcctgtattaagttttcaattcaagcga
ttcgagcacaaaaccaacgacaaatcatctgctcgaaaaatagacgcacaggttcggttc
ccagcttcaatcaacatggcgccgtacaccacgcttgtaataaaagacatggagggggct
aacgcgaacgatgctagatatacgtgccctgctccggaggtgatgtatgagtatgacctc
ttcgccgtgatcaatcatgaaggacagattgatacggggcattacaccaattacgcgtgt
ttccaagatgagtggtataaattcgacgacgacaaagtaacaccatcaacactgggcgcg
tgcctcgcctccgccgcatatatgtgtttctacgtgaagcgacacttggactacaaaccg
aacatcaagccatcgtacgtccaggcacatgaagcggaggcggtgagggagaaggagcta
gagagggagagggaggcggcacggattaaagatgtggaggatgcgcttttggctactgtc
taa

DBGET integrated database retrieval system