KEGG   Laccaria bicolor: LACBIDRAFT_306015Help
Entry
LACBIDRAFT_306015 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
lbc  Laccaria bicolor
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LACBIDRAFT_306015
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     LACBIDRAFT_306015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 487 aa AA seqDB search
MGDAEQSPLTVTLRVPSSQSPVSLTLTANSLLIKGSNLQHVPLLHVLKAHFDPESRILNV
AYLAERGGKKHSPLVNIEGKVEDGNAVSTTASWAENVLQACYEGLSVERSRRLLVFVNPH
GGTKKAVSIFVKVVEPIFRAAGCGLDVIYTTHQGHAYEVVKESPLEYAAIITVSGDGLIH
EVINGLSHHGNPIKALSTPVAPIPAGSGNGLSLNLLGIKDGFDVGLAALNVIKGRPMKVD
LFSMTQGGKRSLSFMSQALGLMADLDLGTEHLRWMGDTRFMVGLLKGIAQLKPCPIQLSF
KVAETDKHKMAEHLVTSRKEFEKDNISGSLPSNSITKMPERSALPPLNYLPDDADGWTSF
NEPLIYVYAGKGPYVGRDFMAFPVSLPNDGLIDVSVMPLSPRMDILAAISGAAEGENYWK
SSIKYVKAHAYRVKPLKPKGNLSVDGESFPFEEFQVEVHQGLGRFLSMYGQYAVDFASQN
PASGQFD
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgctgaacagtcgccgctcactgttactttgcgcgttccgtcctcgcaaagc
ccagtttccctcacacttacggcaaattctttgttgatcaaagggtcgaatcttcaacac
gtcccgcttttacacgtcctcaaggctcatttcgatcccgagtctagaattctcaatgta
gcctatttggcagaacgtgggggaaaaaagcactcgcctttggttaacattgaaggcaaa
gtcgaggacggaaacgccgtttccacaacagcgagttgggcagaaaatgttttgcaggct
tgctacgaaggtctttctgttgaacgctcacgtcgattactagtttttgtcaatccccac
ggtggcacgaaaaaggcggtctcaatctttgttaaggttgttgagcccattttccgcgcg
gcaggttgtggactggacgttatttatacgacccaccagggccatgcctacgaagttgtg
aaggaatcaccgcttgaatatgctgctatcatcacagtttctggtgacggtttgatccac
gaagtgatcaacggactttctcatcacggaaaccctatcaaggcgttgtctacgcctgtc
gctcctatacccgctggatcaggcaatggcctgtctctgaatttgttgggaatcaaggat
ggctttgatgtcggacttgcagcgttgaatgtaatcaaaggtcgacccatgaaggtcgat
ttgttttccatgacgcaagggggaaagcgtagcctatcctttatgtcgcaagctctaggt
ctaatggcggatcttgaccttggaacggaacaccttcgctggatgggagatacacgcttt
atggtcggccttttgaaaggaatcgctcagctaaagccatgccccattcaattatctttc
aaggtcgctgagacagataaacataagatggctgaacatcttgtgactagtcgaaaggag
tttgaaaaggacaacatctctggctctctgccaagtaattcaataacaaagatgcccgag
aggagtgcccttccaccacttaattacctccctgacgacgccgatgggtggacgtcgttc
aacgagcccctcatatatgtctacgcaggaaaaggaccatatgttgggagagattttatg
gccttcccggtgtcattgccgaatgacggactcatagatgtgtcggttatgccactgtct
ccgcgcatggatatattggcggcaataagcggcgccgctgaaggggagaattattggaaa
tccagtatcaaatacgtgaaagcacacgcgtacagggtgaaaccattgaagccaaaggga
aatttgtcagttgacggagaatcgttccctttcgaggagtttcaagtcgaggttcatcag
ggtctaggaaggtttttaagcatgtatggtcaatatgctgtcgactttgcttcacaaaat
cccgcaagcggccaattcgattga

DBGET integrated database retrieval system