KEGG   Laccaria bicolor: LACBIDRAFT_307385Help
Entry
LACBIDRAFT_307385 CDS       T01044                                 

Gene name
HAG16202
Definition
histone acetyltransferase, GCN5 superfamily
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LACBIDRAFT_307385 (HAG16202)
Transfer RNA biogenesis [BR:lbc03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    LACBIDRAFT_307385 (HAG16202)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 556 aa AA seqDB search
MVQGTKIDGPSQAEQLLRVTSGIASELIKAHDANESVSLNEIRSRISKKYVFGGVPRLVD
IISAIPDEYKKALLPKLKARPIRTASGIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSD
FDYSTQSYTGYEPTSMRAIRARYDPYEQTRGRVEQLKSLGHNVDKVEFIVMGGTFMSMPE
DYRGKFIAQLHNALSGFTGTDVDEAVRYSEQSKSKAIGITIETRPDYCLRPHLSQMLRYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVSESFHLAKDAGFKVVAHMMPDLPNVGVERDLE
QFKEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYKNYTPNVLVDVVARILALVPPW
TRVYRVQRDIPLPLVTSGCENSGNLRELALNRMKDFGAVCRDVRFREVGIHEIHHKVRPE
AVELLRRDYTANGGWETFLSYEDPEKDILVGLLRLRKCSDEGTFRPELVKKDGDAGGCSI
VRELHVYGTAVPVHGRDPTKFQHQGFGTLLMEEAERIAREEHGSIKLAVISGVGTRDYYR
KLGYELDGPYMSKSLL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagggaacaaaaattgacggtccatcccaggcggaacaactcctccgcgtaaca
tcaggaattgcgtcagaactgattaaagcgcacgacgccaacgagtcggtctcacttaac
gagatccgctcacgaatcagcaaaaaatatgtgtttgggggtgtacccaggcttgtggat
attatcagtgccattcctgatgagtataagaaggcattgttgcccaagttgaaggcgagg
cctatcaggaccgctagtgggatagctgtggtggccgtgatgtgcaaaccacatcggtgt
ccgcatattgcgatgacggggaatatatgcgtgtactgtcctggaggacctgactctgat
tttgactacagcacgcagagctatactggatacgaaccgacgagtatgcgtgccattcgg
gcgcggtacgacccctacgaacaaacgcgagggagggttgagcagttgaaaagtctgggg
cataacgttgacaaggttgagttcatcgtcatgggagggacattcatgagcatgccagag
gactatcgtggaaagtttattgcgcaactgcataatgcactttctggtttcacaggcacg
gatgtagatgaggctgttaggtattccgaacagagcaaatcgaaagctattggaattacc
atcgagacacgaccggactactgtttacgaccacatcttagtcaaatgctccgatacggc
tgcactcgtctcgaaattggggtgcagtcggtttacgaagacgtggcccgcgatacgaac
cgcggccacacagtacgcgcagtttccgaatccttccacctcgccaaagatgctggcttc
aaagtcgtcgcgcatatgatgcctgaccttccgaacgtcggcgttgagcgtgacttggag
caattcaaggaatactttgagaaccctgcctttagaagtgacggattgaagatatatcca
acactcgttatccgaggtacggggctttatgagctctggcggaccgggaggtataagaat
tatactccgaacgttttggtggatgtagttgcgcgtatactggcgcttgttccgccatgg
acgagggtttatcgagttcagcgtgatattcctttgcctttggtgacaagcggctgtgaa
aactctgggaatctgcgagaattggctttgaatcgaatgaaggactttggtgccgtgtgt
cgagatgttcgcttccgtgaagttggcatccacgagatacatcacaaggtccgtccagaa
gcagttgaacttctccggcgagactacaccgcgaacggaggatgggaaacgttcctttcg
tatgaagatccagagaaggacatccttgttgggcttttgcgactgagaaagtgctcggat
gaaggtaccttccgtccggagctggtgaagaaggacggtgacgcaggtgggtgtagcatt
gtgcgggaacttcatgtctacgggaccgctgtgcctgtgcatggtcgagaccccaccaaa
ttccaacatcagggtttcggcacattgttaatggaagaagctgaacgaatagcgagagag
gagcatgggagtatcaagttggctgtgatctcaggtgttgggacacgcgattactacaga
aagctaggatatgagttagatgggccgtacatgagcaagtctttgttatga

DBGET integrated database retrieval system