KEGG   Laccaria bicolor: LACBIDRAFT_307470Help
Entry
LACBIDRAFT_307470 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 949 aa AA seqDB search
MASPHPPYSHPGPGGPSSYYQPSPPPSHHVYGSHSPGPGPNYQYQYPPPPPTHMGPHHPG
GYPQPAPSRSTARGGSYSRAVHNYHGYHQQPHHQSYSNPHPIHAPHPQPPPPQHGPYSPH
PTKYNQPYPPSYAYPHPPPQATYSPSWQSSQPLSPLPKQLTMPPPQNVLSGYSEPPPAQQ
SEPVAAIETPAVKTPKSAEISIEPIPAVEPEEHGKPPPAPSSPPPPSSSPVLPQSSSYSH
VGTINTFDPLTSAAPPHPPTESPSNQPSSPPPASVTSMAPWAIWSRRPQDPSLAPSIIIS
PRARPPPEIVERALNLRTPPPSPPVSPLATTKKVLPPAVSTVEEEEAEKESLPEQSVDEE
PVSTAAWSSETNSTVPSYAATETTYTPTVPGSPSTTNTSVSVAGTPAKEAGAKLAPETAN
GVVEEPDSKAPAALDAPLLVEEAAPSQATPEPAPAAATPAIPPPKKSWASLLRPASSTST
PTHTKNALPTSSVVGFSIPAEASSSPAGTSSTAPPSTITTQQQPVLKSELVALLTHNPTS
TLSSARIRSRGLVNSGNMCFANSVLQILVYCAPFYQLFGELGRVMPEPVVGKESQSQKEQ
PLVAATVAFLKEFKGKDVVGAGGARNGSVGRKGKEREEREQLDDWDGDSFLPSYVYDAMK
EKKRFDNMRGGHQEDAEEFLGFYLDTLEEELLSILHSVSPSRQKAAPAPVEEKEEAAPPE
QDGWLEVGKRNRTVVTRTIKATESPITRIFGGKFRSTLRAPRQKDSVIVEDWRSLRLDIQ
REQIHTIQDALSYISHPQPVQVTHPSQPGITIDATQQVLIDALPPILILHIKRFCYDTTV
GGVVKVGKQVLFGPELEIGPDLMSTTVRKSHPTKYKLFGALYHHGHSASGGHYTLDVLHP
NRYPGATKSREGWVRIDDELVSDVRYEDVFGVSERDDSRCAYLLFYRRI
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcccacatcctccttactcacatccggggccaggcggaccttcgtcgtattac
caaccttcacccccgccctcccaccacgtctacggctcccacagtccaggtccaggcccc
aactatcaataccagtaccctcctccacccccaacccacatggggcctcatcatcccggt
ggatacccgcaaccggctccttctcgctcgacagcacgcgggggctcgtattcaagggca
gtccataactaccacgggtatcaccaacaaccacaccatcaatcctactcgaatccgcac
cctattcatgcaccccatccgcaacctcctcccccacaacacggcccttactcgccacat
ccaacaaaatacaatcagccgtatccaccctcgtacgcttacccacacccaccacctcaa
gccacgtattctccctcgtggcaatcgtcccagcctctgtcgcctcttccaaaacaattg
accatgcctcctccccaaaatgttctatctgggtatagcgagccgcccccggctcaacaa
tctgaacctgtagctgctattgagacgccagctgtcaaaaccccgaaatcagctgaaatt
tcaatagaacccattcctgctgttgagccagaagaacacggtaaaccaccacctgcacct
tcctctcctcctcctccttcctcttcgcctgtcttacctcaatcttcctcttattcccat
gtgggaactatcaacacttttgacccacttacctccgcagctcccccgcatccgccaacc
gaatcaccttcaaaccaaccctcatctccccctcccgcctctgtgacatctatggcgccc
tgggccatctggtcgcgcagacctcaggacccttcactcgcacctagcatcatcatatct
ccccgtgcacgtcccccacctgagattgtagaacgagcgctcaacctgagaacacctccg
ccttctccgccagtttcccccttggctactactaaaaaagttcttccaccagcagtttct
actgttgaagaagaagaggcggaaaaagagtctttaccagaacaaagtgtggatgaggaa
cctgtatcgacggctgcttggtcctctgagacgaattcgactgttccctcttatgccgct
acggagacgacgtatacgcctaccgtacctggctctccttctaccaccaacacttccgtt
tctgtggcaggtacaccagccaaagaagctggagcgaagttggctcctgaaactgccaac
ggtgtcgttgaagaacctgattcgaaggcaccagctgcccttgatgcccctttgttggtt
gaagaggccgccccaagtcaggctacaccagaaccagcgcctgctgcagctacaccagca
atcccacctcccaaaaaatcatgggcgtccctcctccgtccagcatcctccacatccaca
ccaacacacaccaaaaacgcgctacccacctcctccgtcgtcggtttctccatccccgcc
gaggcttcatcatcaccagcaggcacctcatcaaccgcacctccaagcaccatcacaact
caacaacagcccgtcctcaaatccgaattggtagcactcttgacacacaacccaacgagc
acactgagcagtgcgcgtatccgctcccgagggctcgtgaacagcgggaacatgtgtttt
gcgaattcggtgctgcagatccttgtgtattgtgcgccgttttatcagttgtttggtgag
cttgggagggttatgcctgagcctgttgttgggaaggagagtcagagtcagaaggagcag
ccgttggtggctgcgactgtggcgtttttgaaggagtttaaggggaaggatgttgttggg
gcaggtggtgcgaggaatgggagcgttgggaggaaggggaaggagagggaggagagggag
cagttggatgattgggatggtgattcgtttttgccgagttatgtttatgatgcgatgaag
gagaagaagaggtttgataatatgcggggcggacatcaggaagacgcggaagagttcctt
gggttttatttggataccctggaagaagagttgctttcgatattgcattctgttagcccg
tcacggcaaaaagctgcgcctgctcctgtggaggagaaggaagaagctgcgcctcctgag
caggatgggtggttggaggtcgggaagaggaacaggacggttgttacgaggacgataaaa
gctacggaatcaccgataacgcggatatttggtggaaagttcaggtcgacgttacgtgcc
ccacgacaaaaggattctgtcattgtagaggactggcggtccctacggcttgatatccaa
cgtgaacaaattcatacaatccaagacgcgctctcctatatttcacatccccaacccgtt
caagtgacgcacccgtcgcagcctggcatcaccatcgacgcaacgcaacaagtcctcatt
gatgcgctcccaccgattttgatattgcatattaagcggttctgttatgatacgactgtt
ggtggggtggtcaaggtcggcaaacaagtgctttttgggccagagttggaaatcgggcct
gatttgatgtcgacgacggtacggaaatcgcatcctacgaagtataagctctttggggcc
ctctaccaccacggccactccgcgtcaggggggcactataccctggacgtcctccacccc
aaccgataccctggcgccaccaagtcgcgagaggggtgggtgcgcattgacgatgagttg
gtgtcggatgtgaggtatgaggatgtgtttggggtttcggagagggatgattcgcggtgt
gcgtatttgttgttttatagacggatttga

DBGET integrated database retrieval system