KEGG   Laccaria bicolor: LACBIDRAFT_311304Help
Entry
LACBIDRAFT_311304 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 916 aa AA seqDB search
MQKIDRSQVSNGYRPVCNQVYLSYIRYGHWLVTCTHMYLPLPEQFSLWCIDLLTSDTFQQ
TAPLLCVILFPAFIFLLVNTAHQRVMGFGDSLTITLPPWLWLSASGDGSSARGSTREKKK
SKKHGVRTRAEQAALNGSAKHGSEKDGEYYSGLVNTSGTYCFMNSTLQALASLTYLQPHI
DAIHAKAEVLDVPTPIIDALQDLFRRLNTPRSTHHSIRPTEIIEVLSSQTEGRTNSLFYS
REHQDAQELFQVLSECIKNEIAAVDKEGHRDRGLGGLAQVPSETMREIGKSVFDGLTANR
RSCVLCGYTEAVMHFALDNWQLAVPRLATSCRLEDCLEEYTRLEILKDCICRKCSVVATH
HRLLREIHTLEEATKPEARPSSSKKRRLKEVKRMEARVKAAITQGRIEDDLKDIRLEKVT
SPASTKQSMIARPPPILALHINRSVHFGQYASKNTIKLIFPEVLDLTPYTTSGSLSTVPT
SAISTPPPAIPRSTTPTPKTRGVAGGERTIYRLAAVVCHYGQHSFGHYIAYRRKPPLPSV
GGEGRERWVPPRIVDPIKVEEMMMMKGEGGDDSLGFEIPEYVFEDDPLVNPSSSRRGRGW
LRISDDSVRECGIESVLQEGSGAFMLYYERAEHAVRAYPSLDSSSSVRTTGSEETLKPEI
RTLDLNGSVGSLVSEVGVGVKKEASSSSSALLVEEDKDKGKGRMSSPLVLGTSPSHSQLL
GPRVVRSVAAVRARTVEREAAGSASVSSSLSSLGSLGSRSSHPSASSSSSGVTKSSSSSW
PNNGLMKSPSLPNNGVSSPNKNGVTKSPSLPTTSTQPIPIPIPKNSKKAGPLQINGRPHF
VEEEEMGEEGMMTASAPSILVNPNPKTTHTNTNTSTRKAEEEEEQRTTGKKPPPPPRIQS
PKPIHPSPVVHVGLKA
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagattgatcgaagccaagtaagtaatggttatcggcccgtgtgtaatcaagtg
tacctgagttatatccgctacggtcactggttggtgacttgcactcacatgtacctgccc
ctccccgagcaattttccctgtggtgcatcgacctcctcacaagcgacactttccaacaa
acagcgccccttctctgcgtcatcctcttccccgccttcatcttcctcctcgtcaacact
gcgcaccagcgcgtcatgggtttcggggacagcctgacgatcactctccccccgtggctt
tggttgtcggccagcggggatggatcgtcagctagggggagtacgagggagaagaagaag
agtaagaaacatggagtgaggacgagagctgagcaggcggcgttgaatggctctgcgaag
catggttctgaaaaggatggagaatattattctggcctcgtcaacacatctgggacctat
tgcttcatgaactcgactctccaagccttggcctccctcacctacctccaaccccacata
gacgccatccacgccaaagccgaggtcttggacgtcccaacacccatcatcgacgcactg
caggacctattccgacgactaaacaccccccgatcaacacaccactccatccgcccaacc
gaaataatcgaagtcctaagctcccaaaccgaaggccgcacaaactcgctcttctactcc
cgcgaacaccaagatgcccaagaactcttccaggtcctctcagagtgcattaagaacgag
atagccgccgtcgataaggaaggacatagggatcgcgggttgggtgggttggcgcaggtg
ccgtcggagacgatgagggagattgggaagagcgtgtttgatgggctgacggctaatcgg
aggagctgtgtgttgtgtgggtatacggaggccgtgatgcatttcgcgttggataattgg
cagttggccgttcctaggcttgcgactagttgtagactagaagactgcctcgaagaatac
acccgcctcgaaatcctcaaagactgtatttgcaggaaatgctccgtcgtcgctacgcac
caccgcctcctacgggaaatacacacactggaagaagcgacgaaacccgaagccaggcct
tcctcatcaaagaaacgcaggctgaaagaggtgaagcgcatggaagcgagggtgaaagcc
gccataacacaaggcaggatagaggacgacctaaaagacataaggctcgagaaagtaacc
agcccagcgtccacgaaacaatccatgatcgctcgccccccacccatactcgccctccac
atcaaccgctccgtccactttggccaatacgcctccaaaaacaccataaagctcatattc
cccgaagtcctcgacttaacaccctacaccacctccggaagcctctccacagtccccacg
tccgccatatcaacacccccacccgccattccccgcagcacgacgccgacgcccaagacg
cgcggagtggcagggggggagaggacgatatataggttggcggctgttgtgtgtcattat
ggacaacattcttttgggcattatattgcgtatcgcaggaaaccaccactaccgagtgtt
ggaggggagggaagggagaggtgggttccgccgaggattgtggatccgattaaagtggag
gagatgatgatgatgaagggcgagggcggtgatgattctcttgggtttgaaatcccggaa
tacgtgtttgaagatgatcccctcgtcaacccatcatcatccagaagaggaagggggtgg
ttgaggataagcgacgactctgtgcgtgaatgcggtatcgagtctgtcctacaagaaggc
agcggggcgttcatgctctattacgagcgtgcggaacacgccgtacgggcgtacccttcc
ctcgactcttcgtcgtcggttaggacgacggggtcagaggagacgttgaagcctgagata
aggactttggatttgaatgggagtgtggggagtttggttagtgaggttggggttggggtt
aagaaggaggcgtcttcgtcttcttctgctttgttggtggaggaggacaaggacaaggga
aaggggaggatgtcgtctcctttggtattgggtacttccccttcacattctcaactcttg
ggcccgagggttgtgaggagtgtggctgctgttcgggcgaggacggttgagagggaggcg
gctggctcggcgtcggtttcttcttcccttagttcgttgggttcgcttgggtcgaggtct
tcccatccttcagcatctagcagcagcagtggggttaccaagtcgtcttcttcttcttgg
cccaacaacggtcttatgaagtctccttccttacccaacaacggtgtttcgtcccccaac
aagaacggagttacaaagtctccttcactacccaccacttctacccagccaatacccata
cccataccgaagaactcgaagaaggcggggccgttacagataaacgggaggcctcatttt
gtcgaagaagaagagatgggggaggaggggatgatgacggcttcggcgccttcgatattg
gtcaatcccaatcccaagacgacgcacacgaacacgaacacgagcacaaggaaagcagag
gaggaggaggagcagaggacgacggggaagaagccgccgccgcctccacggatacagtcg
cccaagccgatacatccttcgcctgttgtacatgttgggctcaaggcgtag

DBGET integrated database retrieval system