KEGG   Laccaria bicolor: LACBIDRAFT_311826Help
Entry
LACBIDRAFT_311826 CDS       T01044                                 

Gene name
PDIA
Definition
protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
lbc  Laccaria bicolor
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LACBIDRAFT_311826 (PDIA)
Enzymes [BR:lbc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LACBIDRAFT_311826 (PDIA)
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LACBIDRAFT_311826 (PDIA)
  Exosomal proteins of colorectal cancer cells
   LACBIDRAFT_311826 (PDIA)
  Exosomal proteins of bladder cancer cells
   LACBIDRAFT_311826 (PDIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 505 aa AA seqDB search
MRVSTLSSSAAYLLSLAAFVVADAASDVLSLKAADFEAAVAAEPLILVEFFAPWCGHCKA
LAPHYEEAATALKEKNIKLAKVDCVDEADLCQSKGIQGYPTLKIYRSGQATEYAGPRKAD
GIISYMVKQSLPAVSEVSSSNYAEFQKADKVVAIAYLTSTTDAPAPEFSITAEAHRDDYL
FGISTDQDAIAAAGVTPPAIVVYRSFDEPKSEYPYPISSVTSKDLEDWIQELSIPVIDEV
SSENYAVYAGSGKPLAYLFLDPTSDGKDAHIAAIRPVAQKYKSKVNFVWIDALKFADHAK
ALNLLEPKWPAFVVQNLEHQHKYPFDQAQEVTPAAAADWVEQYLAGKLQPELKSAPIPET
QDDNTYTLVGKNFDEIVFDDKKDVFIEFYASWCGHCKRLKPIWENLGEKYAAIKDRLLIA
KMEAQENDLPLSVPFRISGFPTLKFKPAGSKEFIDYEGDRSYESLVAFVEEHAKNSLELP
KVAEAEEVVQVPLASDASDSKHDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtatccactctttcatcgtcggcggcgtatttgctgtccctcgctgcctttgtc
gtggctgatgcagcctctgatgttctttctctcaaggctgccgactttgaagctgcagtt
gcggctgagcctctgatactcgtcgagttctttgcaccatggtgtggtcattgcaaggct
ttagccccccattacgaggaagccgccacggccctcaaggaaaagaatatcaagctcgct
aaagtcgactgtgtcgatgaggctgatctgtgtcaatcaaaaggaattcaaggttaccca
actttgaagatttaccggtcaggtcaggcgactgagtacgctggtcccagaaaggcggac
ggcatcatcagttatatggtcaaacaatcccttcctgctgtttcagaagtctcctcgtca
aattacgctgaattccaaaaggcggataaagtcgtcgccattgcatatcttacttcaacg
accgacgcaccggcacccgagtttagcatcactgccgaagctcaccgcgacgactacctt
ttcggcatttcaactgaccaggatgcaattgccgctgctggagtgacacctcccgccatt
gtcgtctatcgtagctttgacgagcccaaatcggagtacccttatcctatctcttcagtc
acctccaaggacttggaagattggattcaggagctctccattcccgttattgatgaagtt
agcagcgaaaattacgctgtttacgcaggtagtgggaaacctcttgcctacctcttcctc
gatcccaccagcgacggcaaggacgcccatattgctgccatcagacctgtagcccaaaaa
tacaagtcgaaagtcaatttcgtctggattgacgccctcaagttcgctgaccatgccaaa
gccctaaaccttttggagcccaaatggcccgccttcgttgtccaaaaccttgaacaccaa
cataaatatccatttgaccaggcccaagaagttacacctgccgctgctgctgactgggta
gagcaatatctcgcaggcaaactccaacctgaactcaagagtgcaccaatccccgagacc
caagatgataacacatacacccttgttggtaaaaacttcgatgaaattgtctttgatgac
aagaaggatgtattcattgagttctacgcctcttggtgcggtcactgcaaacgcctcaag
cctatatgggagaatttaggcgagaaatacgccgctatcaaggatcggcttctcattgcc
aagatggaagcacaagaaaacgacttgcccctttccgttcccttccgcatttcgggtttc
cctacattgaaattcaagccagctggttccaaggaattcattgattacgagggtgatcgt
tcatatgaaagcctagttgccttcgtggaagaacacgctaagaactcgctcgagttgcca
aaggtcgcggaggccgaggaggttgtccaagtgcctcttgcatccgatgcttcggactct
aagcatgacgagctctaa

DBGET integrated database retrieval system