KEGG   Laccaria bicolor: LACBIDRAFT_312055Help
Entry
LACBIDRAFT_312055 CDS       T01044                                 

Gene name
HDA16206
Definition
histone deacetylase complex protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LACBIDRAFT_312055 (HDA16206)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 614 aa AA seqDB search
MATMPSDLLVTKKAFAFFQNACLQHRFIRSKDTSNIVERPERLRAVSIGLAAAIARLEEV
VSSGAPNQTTSSSTAKQPDPNDLAEVMGRMKLEHDSPLFVRSPVSVVQSQATVDILNNPA
VKFVHGDIEGDVYLENLKAWVKGSSDKVLNNECEIPEHLSQGDLYRRLFAICVTRPKRLI
LFLVCPESIDAIQGAVGTVCQAVDMVVASSRGASGASGASSTSRRAFVAIRPPGHHCGED
TPSGFCFINNVAVGAAHAHLQHGINRIVIVDIDLHHGNGTQSIVWQINEETYRKVLEQKG
GGPPSSPGPQIYYGSTHDILSYPCEDGKLNLIQAASVSIHKSHGQYIENVHLQEYTSEEH
FWDALYKHEYSKVLRRAEEFLDGTGGPGDDVMVFISCGMDACEHEYESMSRHNRKVPSSF
YYRFAQDACALSEKYARGRVVSVLEGGYSDRALISGAMAHMCGLVDLPSSLKIEEDWWSV
ENLIKLEKLTKRRRGGRPSLGASGSAEPWLERTIAILEPLETLSVSSSRRPIASTPPTSM
TLRDRTKVKTTSAAGSPSRPSTTPAKSTVPASASAPNASGTSGFEAGSTEGDATRTNKLP
RVILRLGPKPPDTT
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatgccttctgatttgcttgtaaccaagaaagccttcgcattctttcagaat
gcgtgtcttcaacaccgcttcattcgatccaaggacacatcaaatattgtagaacgacca
gagcgtctcagagctgtcagcattgggctggctgcggcaatcgctcgtctagaagaggtt
gtatctagtggcgcaccaaatcaaacaacctccagcagcacagcaaagcaacccgatcca
aatgacttggctgaagtcatgggtcgaatgaagctagagcacgattctcctttatttgtt
agatcaccggtttcagtcgttcaaagccaagccaccgtcgacattttgaacaaccctgcg
gttaaattcgtccacggcgatatcgagggagatgtgtatctcgaaaatctcaaggcatgg
gtcaagggcagctcagataaggtcctcaataacgaatgtgaaattcccgaacacctttcg
cagggagacttgtatcgtaggctcttcgcaatttgtgtgactcggccgaaacgactcatt
ctcttcttagtctgtcccgaatcgatcgacgcgatacaaggtgccgttggtaccgtttgc
caagccgtagatatggtggtcgcatcttctcgcggggcgtccggagcatctggggcctcc
tcaacgtctcgtcgagcatttgtcgcaatccgaccgccgggacaccactgtggtgaagat
acgccctctggcttttgttttataaacaatgttgccgtaggtgccgctcatgctcacctt
caacatggaatcaatcgcatcgttatagttgatattgatctccaccatggcaacggcact
cagtctatcgtatggcaaatcaacgaggagacctatcgcaaggttcttgagcaaaaaggg
ggtggaccaccctcctcacctgggcctcaaatttactacggatccacgcacgacattctt
tcgtacccgtgcgaagatgggaaactcaatcttatccaggcggcttcggtctccatccac
aaatctcatggacaatacattgagaatgttcatctgcaagaatatacttcagaagaacat
ttctgggacgccctgtacaagcatgaatatagcaaagtcttgcgaagggcagaagaattt
ctggatggtacaggcggccctggcgatgatgtcatggtattcatcagttgtggaatggac
gcttgtgagcacgaatacgagtcgatgtcgcgccacaaccgtaaagttccttcgtccttt
tactatcgcttcgcgcaagatgcttgcgcgttaagcgaaaagtacgcgcgaggacgtgtc
gttagcgtcctagaaggcgggtatagcgaccgtgcactgattagcggcgcgatggcacac
atgtgtggattagtagatctaccatcctctctaaaaatagaggaggattggtggagcgta
gaaaacttgatcaagctcgagaaattaaccaaaagacgccgaggcggcagaccttccctc
ggtgcctctggttctgctgagccctggctggagcggacaattgcgatacttgagccctta
gaaacattgtcagtgtcgtcctctcgacgtcccatcgcatccacacctcccacatcgatg
accctacgcgataggacaaaggtcaagacaacgtctgcagcaggatccccttctcgcccc
agcacgacgccggcgaagtccactgtgcctgcctcagcttctgctccaaatgctagtggt
acatcaggttttgaggccggttcaacagaaggtgatgctactcggacaaacaagctacca
cgcgttatcttgaggttgggcccgaagccccctgatacaacttga

DBGET integrated database retrieval system