KEGG   Laccaria bicolor: LACBIDRAFT_312288Help
Entry
LACBIDRAFT_312288 CDS       T01044                                 

Gene name
SDG16204
Definition
SET domain-containing protein
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LACBIDRAFT_312288 (SDG16204)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 657 aa AA seqDB search
MQNTAPSEPHHHNPQRLWQSLLRKVSTFFGGKNLAPGLYLYFLSLFGANTESPMNSSIPQ
GENSDVDSLAETADLVCRVSETVSSEFYAWDINYCQKTLHSLLVKAPASPRCLTKETGGT
HAQTARKGKGRSRPKRADEEVENFDITDGPEGCTSTIVPVEVVKLDEALRPYPSYETCTP
LTRSICVGDDPHLMPFMPFSDDPEFDYMSYNEQYKFFLWQIPNRDPDCAYLLHLHRHLAR
INFFTTEVEVIVVEIARRLHSEHQLSLEAIDQVAVLPLQLDRLVGVSRRRDYPKWLDFEQ
ATSLPYHSPFSTASEHPHGQLPNLLQYFCNNSSCLVGYCTIHNEEIPMPNLIPPSVRNNA
LIASVEKPCGSLCFVLGGVSSSIPSVWTESEMQTLRILMDYSPDILPCDAAIICRKPCRE
VFKHRQDPPKTKKSIGKAKPITGTIDHDAKTFVPDYPCSHPGPCDGRADCACFHNKAHCE
VACRCDLSCPRRRRGCHCKKDVTGKLCYSARCPCYRAHRECDPVLCVDCDARCGDTASAA
CQNVSLQQGRFKRTEVRQSRWGLGLFLVEPAEKNDLISEYTGELILDPTRESREIVATHR
NRNYVFELNSAFSLDSGGAGNETRYINHQTGELANCTAKIRLVNGEHRIGIYACELQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatactgctccttccgaaccccatcaccacaaccctcaaagactctggcaatcg
cttctcagaaaagtatcgactttctttggaggcaaaaatttagctcctggactatattta
tatttcctgtctttatttggcgcgaacactgaatccccgatgaatagctctatcccacaa
ggtgaaaactcggatgtcgactcactcgcagagactgccgaccttgtctgcagagtttca
gaaacggttagctcggaattttatgcttgggatataaattattgtcaaaaaactctccac
tcgcttctggtaaaggccccagcatccccccgttgtctaacgaaagaaaccggaggcaca
catgctcaaacggctcgcaaagggaaaggcagaagtcgccccaagcgcgctgatgaagaa
gtcgaaaattttgacatcaccgatggtccggaaggttgtacctccacgatcgttccagtt
gaagtggtgaaactcgatgaagcgctcagaccttacccaagctacgaaacatgcacgccc
ctcacgcgcagcatttgcgttggcgatgatccccacctcatgccgttcatgccgttttct
gacgacccagagttcgactatatgtcgtacaatgaacaatataagtttttcttgtggcaa
atacccaatcgcgacccagactgtgcgtatctccttcacttacatcgacatttagcgcgc
attaattttttcactaccgaagtggaagttattgtagttgaaattgcacgcaggttacat
tcagaacatcaactgtccttggaggcaattgatcaagttgctgtccttccacttcagtta
gatcgacttgttggtgtaagtcgtcggcgtgattatccaaaatggctcgatttcgagcaa
gcgacttctcttccatatcattcccctttctccacggcttcagagcaccctcacggacag
cttcccaatcttttacaatacttctgcaacaatagcagttgcctagttggttactgtact
atccataacgaagaaatacccatgcctaatttgatacccccttcggttagaaataatgcg
cttatagcttctgtggaaaaaccatgcggatccctgtgcttcgtgcttggcggcgtttcc
tcctcgattccctccgtgtggacggaaagcgagatgcagacgctgagaattctcatggac
tactctcccgacatattaccatgcgatgctgctattatttgtcgtaagccttgtcgagag
gtattcaaacaccgtcaagacccgccaaagactaaaaagagcatcggaaaggctaaaccg
atcacaggaacaatagatcatgacgcaaaaacctttgttcccgattatccatgcagtcac
ccaggtccatgcgatggacgagcagattgcgcttgtttccataacaaggcgcactgcgaa
gttgcttgtcgctgtgatctttcttgtccgcgcagacggcggggatgccattgcaagaaa
gatgtgacgggaaagttgtgttacagcgcaagatgcccctgctacagggcgcacagagag
tgtgatccagtcctttgcgtggattgcgatgccagatgtggagatactgcatcggccgcc
tgccagaacgtctcccttcagcaaggacgattcaagcgcaccgaagtccgtcaaagccgg
tggggcttgggtcttttcctcgtagaacccgccgagaaaaacgacctaatttcagagtat
actggggaactgatattagatcccacccgagagtcacgagaaatcgtcgcaacgcataga
aaccgcaactacgtcttcgagctaaattccgctttctcactcgatagcggcggtgctggg
aacgaaacaagatatataaatcaccaaactggagaactggcaaactgtactgcgaaaatt
cgacttgtaaacggggaacaccgaattgggatctatgcttgtgagttacagtga

DBGET integrated database retrieval system