KEGG   Laccaria bicolor: LACBIDRAFT_313557Help
Entry
LACBIDRAFT_313557 CDS       T01044                                 

Gene name
CHR16205
Definition
DNA repair protein, SNF2 family DNA-dependent ATPase
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
lbc  Laccaria bicolor
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lbc03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1051 aa AA seqDB search
MPPFQELRPPKRKLVDDELSSRKRFTTGLGLAAASTSVDEELVWMVQWRNRQYKKHKTWD
GDAILVVNRSKCTLFDSEGKIMSTGKAEAPLFEGKSFFVGAKEVELDRPVLRTEFLSGQC
FGRHNSIQGRDAFETQNDLAHVKKFVSPVVMKKPLEGAPPGVRAGCLKSENGPPQNFDGV
ASNVRKSYWTANWRKQQNKKHKTWDGDAYISHEGDKLTMISEDGKIMGSTAWKGELLCAG
YSAYISGKEFQLDCEISRSQLPDMKEISLPEESTSHVEDPLHFSGQGSTTNPSVAHEFIS
PASFYAIPKSKPKGPLHDPDAADAVVMKFPSKEHTKSNLNVVPVVLDPILSRRMRPHQKE
GWLTGVSSVRLYSEQLSQGVMFLYECVMGLRKHEGQGCILADEMGLGKTLQTIALIWTLL
KQNLYGSKEPAAKKVLIVCPVSLTTNWKAEFNKWLGKDRVGVVICEKDKSRVNQFFYNKN
QHVLVIGYERLRTVIDTLSSGVSVPAIDLIVCDEGHRLKSANNKTTAILKALRTPRRVIL
SGTPIQNDLGEFHAMAEFCNPGLLDDYNVFRRVYESPILKSRAPDASAKEIEIGETRTAQ
LLSISNSFVLRRDATLLKNHLPPKYEYVVFVTPTALQLSMFSKILRPDRLIDLVQSSTAE
SLALINILTKISNSPILLKAAADKAKIKTSGDAPYILRTGVDEALGLLPDTTHFGDFSLS
GKLIALAKLLTIIRHTTEEKCVLVSHYTSTLNILEAFCQKKGYSYYRLDGQTPQVKRQEY
VNAFNNVSQRSSFIFLLSSKAGGLGINLIGASRLCLIDSDWNPRLVGRRTQLTPTLISDS
HDLQSMARCHRDGQKRPVFIYRFLTTGAIDEKIYQRQVTKLGLSASLIGSAGSSSASKTD
SFSRKEVHIQLQFHFKNSTDVQLRDIFRIHPDTICNTHDLLECQCEESGGRPSDTCEEVQ
PVDPNTEDNVLERGFIAASNVKMDASDPVDTAKKKAALALLSEWKHINCQRSGCHDLIHD
HALRKLVQEGEEAGGSISFLFEKGSESSEEE
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccttccaagaactccggcctcccaaaaggaaattggtcgacgatgaactttcg
agcaggaagcgatttaccacaggtctaggcttagctgccgcctccacctcagtagacgaa
gaactagtatggatggtacaatggagaaaccgtcaatacaagaagcataaaacatgggat
ggtgatgctattcttgttgtcaaccgtagtaaatgcaccctatttgactctgaaggcaaa
atcatgtccactggcaaagccgaagcacccctattcgaaggaaagagcttttttgttggc
gccaaagaggttgaactggatcggcccgttctaaggacggagtttctttcaggtcaatgc
tttggccggcacaatagcattcaaggacgtgatgcgtttgaaactcaaaacgatttggct
cacgtgaagaaatttgtttctcccgtcgtgatgaagaagccattagaaggggcgccccct
ggcgtccgcgcaggatgtctgaaatcagagaatgggcccccacagaatttcgatggagtg
gcttcgaacgttcgaaagtcttactggactgccaattggaggaaacaacaaaacaaaaag
cataaaacttgggacggagacgcatatatatcgcatgaaggcgacaagttgacgatgata
agtgaagatggtaaaatcatgggaagcaccgcttggaagggagagctcctctgcgcgggc
tacagtgcatatattagcgggaaggaattccaacttgattgcgaaatttctaggtcgcag
cttcccgacatgaaagagatcagtctgcctgaagagtcaacctcccatgtcgaagatccc
ctacattttagcggtcaagggtcgacgacgaacccatccgttgctcatgagtttatttcc
cctgcgtctttctatgcaataccaaaatctaagcccaaaggcccactgcacgatcccgat
gccgctgatgccgttgttatgaaattcccaagtaaagaacatacgaaaagcaatctcaat
gtcgtgcctgttgttttggaccccatactctcacggcgaatgaggccacaccagaaagaa
ggttggctaaccggtgtttcgtcggtcaggctctattctgaacaactctcacaaggtgtc
atgtttctgtatgagtgtgttatgggcctgaggaagcatgaaggtcaaggttgtattctc
gccgatgagatgggtctcgggaagacgttacaaacgatcgccttgatctggacattgctc
aaacaaaatttatatggtagcaaagagccagcagccaagaaagttcttatcgtgtgtcct
gtgtccttgactaccaattggaaggccgagttcaataaatggcttggaaaagatcgtgtc
ggggtcgtgatctgcgagaaagacaaaagccgcgtcaaccaatttttttacaacaaaaac
cagcatgttttggtcatcggttacgagcggcttcgaacagttatagacactctttcgtca
ggcgtgtccgtcccagcgattgacttgattgtatgcgatgaaggtcataggttaaagtcc
gctaacaacaagacgactgctatactcaaagctcttcgaactcctcgacgcgtcatcctc
tcaggtaccccgattcagaatgatcttggagaattccatgcgatggctgaattttgtaac
cccggcttgcttgatgattacaatgttttccgtcgagtttatgagtcgccaatcttgaag
agtcgagctccagatgcctctgcaaaagagatcgagattggcgagacacgcacagctcag
ttgctttcgatttccaacagttttgttctcaggagagacgccacccttctcaaaaaccat
cttcctcccaaatatgaatacgtggtttttgtcaccccaactgccctccaattatctatg
ttctcaaaaatcctccggcctgacaggctgattgatcttgtgcagagctcaacagcagag
tctcttgctttaataaacattttgacgaaaatcagcaatagtccaatattattgaaagcg
gcggcggataaggccaagatcaagacaagcggtgatgctccgtacatcctaagaactgga
gttgacgaagcattggggttactcccggacaccactcattttggggacttttcattgagc
gggaagcttatcgctcttgcaaagttattgaccatcatccgccacaccactgaagaaaaa
tgcgtcctggtttctcattatacatcgacgctgaacatactagaggccttctgtcagaaa
aagggttattcgtattaccgattagatgggcaaactccgcaagtcaagagacaagaatac
gttaacgctttcaacaacgtgtctcaaagaagtagcttcatatttctactcagctcaaaa
gctggagggcttggaatcaatctcattggtgcttcaagactttgcttgatagactccgac
tggaatcccaggttagttggacggcgaacacaattgacaccgacgctgatttcagacagt
cacgatttgcaatctatggcgagatgccaccgggatggacaaaaacgacccgtgttcata
taccggttcctgacaactggtgcaatcgacgaaaaaatctatcaaagacaagtcactaaa
ctcggattgagcgcatctctcattggatcggcgggctcgtcgtccgcatctaaaactgat
tcattttctcgcaaagaggtacatatacagctccagtttcatttcaaaaattcaaccgat
gtacagctccgggatatctttcgcatccatcctgacaccatatgcaacacgcatgacttg
ctcgagtgccaatgcgaagagtcgggtggccgcccctcggatacttgcgaagaagtacaa
cctgtggaccccaacacggaggataatgtgttggagaggggatttattgcagcatcgaat
gtgaaaatggacgcgtcagaccctgtggacacagcgaagaagaaagctgctttggcgttg
ctgagcgaatggaagcatatcaattgtcagagatctgggtgtcacgacctcattcacgac
catgctcttcgcaaacttgtgcaggagggagaggaggcaggcggaagtatatcatttctg
tttgagaaagggagcgaatcatcagaagaggagtga

DBGET integrated database retrieval system