KEGG   Laccaria bicolor: LACBIDRAFT_314107Help
Entry
LACBIDRAFT_314107 CDS       T01044                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
lbc  Laccaria bicolor
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:lbc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lbc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:lbc00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 542 aa AA seqDB search
MVAGVQIHSKVAQKAQAELFTDGALKFLAALHRTFESTRQSLLVAREDAQRRYDAGVPLD
FAPETAHIRAEASWHCAPPAPGLEDRRVEITGPTDRKMVINALNSGAKTFMADFEDSSAP
TFANMVNGQINLRDAIRRQIDFEVGGKSYKLSQNPAVLIVRPRGWHLDEPRVTVDNAPVS
GSIFDFALYFYNNAHELVKRGSGPYFYLPKMEHYLEARLWNDIFVFSQSYIGMPHNTIRG
TVLIETLPAAFQMEEILFELRNHSSGLNCGRWDYIFSFIKKRRADRSAVLPDRKDITMTV
GFMDSYVRLLIQTCHKRKVAAMGGMSAQIPIKDDPKANEVAMAKVRSDKLREVTAGHDGT
WIAHPLINKIAREVFDKNMLGPNQYHVLRQEVKVAPSDLLSTKVPGQITLEGVRENVSTC
LAYTAAWVGGNGCIPLNYLMEDAATAEITRVQLWQWVRYGSRISDTGELITVEFVDKLVG
ELAPGIKGLVAGVKEENVKFAMEYLKGQIRRQWPSEFLTSDLMPYLAIADGVEPARQRVA
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccggtgttcaaatccactcaaaagtcgctcaaaaggctcaagcagagctattc
acagacggcgcactcaagttcctcgctgccctccaccgcaccttcgagtcgacgagacag
agcctgctcgtcgctcgcgaagatgctcagcgtcgctatgacgcgggggtgccgcttgac
tttgccccggagacggcgcatattcgcgctgaggcctcgtggcattgcgcaccgcctgct
cctggacttgaggaccgccgcgtagagattacgggtccgacagacaggaagatggtcatt
aacgctttgaacagcggtgcgaagacgttcatggctgattttgaagattcgagtgcaccg
acattcgcgaatatggtcaatggccagattaatttgcgagacgccattcgtcgtcagatt
gatttcgaggttggtggaaagtcgtacaagctctcccaaaatcccgctgtgcttatcgtt
cgtcctcgaggatggcacctcgacgaaccccgcgtaacggtcgataacgcccccgtctca
ggatccattttcgactttgccttgtacttctataacaatgcacatgaactcgtgaagcgc
gggtcggggccatacttttacctcccgaaaatggaacactatcttgaagcgcgtctctgg
aacgatatctttgtcttttcccagtcctatattggcatgccgcataacacgatccgtgga
accgttctcattgagaccctcccggctgcgttccagatggaggaaattcttttcgaattg
aggaaccattcctctggtttgaactgtggacgttgggattatatcttcagcttcatcaag
aagcgtagagctgaccggagtgccgtcttgccagataggaaggacattaccatgaccgtc
ggcttcatggactcctacgtcaggcttctcatccagacatgccacaagcgcaaagtcgcg
gctatggggggcatgtcggcccagatccctatcaaggacgaccccaaggccaacgaagtc
gccatggccaaggtccgctcggataagctccgcgaagtcactgctgggcacgacggcacc
tggatcgcgcacccactcatcaacaagattgctcgtgaggtatttgacaagaacatgctt
ggtcctaatcagtaccatgtccttcgccaagaagttaaagtcgccccgtccgacctgcta
agcaccaaagtgcccggccaaatcacgctcgaaggagtccgcgagaacgtatccacgtgc
ctcgcgtacaccgctgcctgggtgggcgggaacgggtgcatcccgctcaattacctcatg
gaagacgccgccaccgccgaaattacgcgcgtacaattatggcagtgggttcggtacggt
tcgcgcatctcggacacgggtgagctgatcactgtggagtttgttgacaagttggtgggt
gagcttgcgccggggataaagggccttgtggcgggtgtgaaggaggagaatgtgaagttt
gcgatggagtatttgaagggacagattaggaggcagtggcctagtgagtttttgacgagt
gatttgatgccgtatttggcgattgcggatggggttgagcctgctaggcagagggtggcg
gcgttgtag

DBGET integrated database retrieval system