KEGG   Laccaria bicolor: LACBIDRAFT_315547Help
Entry
LACBIDRAFT_315547 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lbc  Laccaria bicolor
Pathway
lbc00562  Inositol phosphate metabolism
lbc01100  Metabolic pathways
lbc04070  Phosphatidylinositol signaling system
lbc04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LACBIDRAFT_315547
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LACBIDRAFT_315547
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    LACBIDRAFT_315547
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LACBIDRAFT_315547
Membrane trafficking [BR:lbc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    LACBIDRAFT_315547
 Endocytosis
  Macropinocytosis
   Phospholipase C
    LACBIDRAFT_315547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_10 EF-hand_like EF-hand_1 EF-hand_7 PH_12 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 6073652
NCBI-ProteinID: XP_001878078
JGI: 315547
UniProt: B0D2M5
AA seq 1046 aa AA seqDB search
MEDPSRMLRRAGNLLTSNGQPVKELDVDSDVPRLPGSPPPRSHKLGLGASIKRRLQEVVG
GSTARSRSVGGLGRSPRTPAPSTDTGNGEVGRSHARSFSDIPTAQAPIFDRPTPSTAQAP
ALSNKRHSVGAQPSSVPEVSNLSGEQEVTSPVSEQQPTASSSASQLEDVLVPQLLQQGTP
MTKVSAKKHKKFVFRLDADLGQIVWESVSKQQKIIPIENIKEIRTGSDARYYRQQFQLAQ
EYEDRWLTIVYILDGAYKTLHLIVATKDVFQIWNKTLRELHAIRQELMRGIGNIEVREAL
WERQHWKGAGEERDQKLTFEEVVRLCRRLNIHSNQEDLFRLFTRADTQQRGFLDFDDFRR
FVKLLKGRPEIDRLYKKLKVDSGGVFVFATFEKFMRDKQKSTLSQDELQAVFDKYTKNTD
SATTMNVDSFTSFLLSPDNCAFSDQHSKVFHDMTRPLSEYFISSSHNTYLVGHQLIGDST
IEGYIRALLHSCRSVELDIFDGDHEPMIFHGKTLTTKVSLREVCQVIKKYGFVASPYPII
LSAEVHCSVAQQDMIAAIMIEVFEDTLIQEPLEELAEGRRIEVLPSPEQLKGKILLKTKN
LLLQGPDPVVGGDVFFSDVSASSTSDSEAWVDATQDPSAVFNGRKRRSESDSVKDQLRKA
RSTVLKRVQSVGKASSSSASSSTTPRRARSPAPSSPHLPAIPISPVPIETTLKPPNTISA
RRPSDTSELSRPKPKMSPALVALLVYTVGVKCRGINKKEEYAPVHMFSLSENAANKMLKF
GMMDLVKHTRTHMVRIYPKGTRVSSTNYEPHRFWCAGAQLVAMNWQTFDLGYMINHAMFQ
RNGRSGFVLKPLALRIGSKDLLSKRTQHRFDVTIISAQQLPRPKNASGHEIMDKSVIDPY
VQVTIHVPDWPWAAPVHGSARKPIPGELASPSQMTTGAGGLGSPSTPRRSISCRTNAVKN
NGFNPVWEEKLRIPFECVGDMMDLVFVRFVVRRQEDKDQEEPLAVYCAPLGSLEHGYRHL
PLHDSQLSQYLFSTLFVKINVTMVEV
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggaagatccaagtcgtatgctacgccgtgcgggcaatctcctcacgagcaacggccaa
ccagtaaaagagctcgatgtcgactccgacgtgcccaggcttccgggatcaccgccaccc
cgaagtcacaaactaggactaggcgcctccattaaacgacggctgcaggaggttgttggg
ggatctaccgcgcggtcacgatctgttggcggtcttgggcgttcaccacgaacgccggcg
ccttcgaccgatactgggaacggagaggttggcagaagtcatgcgcgctcattttccgat
atacccactgcccaggcgcccatttttgaccgtccgacacctagtactgcccaggctccc
gccctttccaataagcgccattctgtgggcgcgcaaccgtcaagtgtcccagaggtgtct
aacttgagtggggagcaggaagttacgtctcccgtgtcagagcagcagcctaccgcgtcc
tcgtccgcttctcagctggaagatgtgttggttccgcagttgttgcagcagggcacaccc
atgaccaaggtgtccgcgaagaagcacaaaaagtttgtgtttcgcttagacgcggatttg
gggcagatcgtgtgggagtctgtgtcgaagcagcagaagattataccgattgagaatatc
aaggaaattcggacggggtcggacgcgcggtattataggcagcaattccagctcgcacag
gaatatgaagatcggtggcttacgattgtctatatccttgatggcgcgtataagacgcta
catctcatcgtggcaaccaaggacgtgttccagatatggaataagactttgcgcgagtta
catgcaattcggcaggagctcatgcgcggaattgggaatattgaagtgagggaagctttg
tgggagagacagcattggaagggggcgggcgaggagagggatcagaagctgacgtttgaa
gaggttgttaggctttgtaggaggctgaacatccattcgaaccaggaagatctgtttaga
cttttcactcgggcagacacgcagcaacgcggatttctggactttgatgatttccggagg
tttgtcaagctgctcaagggaagaccggaaattgatcggttgtataagaaactcaaggtg
gatagtgggggtgtttttgttttcgcaacgttcgaaaagttcatgcgggacaagcagaag
tccacactcagtcaagacgagctccaggccgtctttgacaagtataccaagaataccgac
tcagcaacaaccatgaatgtcgactcgttcacctccttcctcctatccccggacaactgc
gctttttcggatcagcattccaaggtcttccatgacatgacgcgccctctatcagagtac
tttatctcctcatctcacaacacctacctagtcggacatcagctgatcggcgatagcacg
attgaaggctacatccgagcccttttgcacagttgcaggagtgtagaactggacatcttc
gacggcgaccatgagcctatgatcttccatggcaagacactcaccaccaaggtgtccctc
cgggaagtttgccaggtgatcaagaaatatgggtttgtcgcctcgccttatccaatcatt
ctgtccgcggaagttcactgctcggtggcccagcaagatatgattgctgcgatcatgatc
gaggtgtttgaggacactttgattcaggaaccactagaggagctggcggaggggcggagg
attgaggtgcttccgagccccgaacagttgaaggggaagatattattgaagacgaagaac
ctcttgcttcaagggccagatcctgttgtgggcggtgatgtctttttctctgatgtttct
gcgtcttcaacatcagattcggaggcttgggtagacgcaacgcaggacccttcggcggta
tttaatggacgcaaacggaggagtgaatcggacagtgtcaaagatcagctccgcaaagct
cgaagtaccgttttgaagcgggttcaaagtgtgggcaaagcgtcttcatcgtccgcctct
tcgtccaccaccccacgacgagcacgttccccagcaccatcatcccctcatcttcccgca
atccccatttctcccgttccgatcgagactactttgaaacccccaaacacaatttccgcc
agacgcccatctgatacatctgaactttcccgaccgaaacccaaaatgtcgccagcactt
gtggcattgctggtatacactgtcggtgtcaaatgtcgcggaattaacaagaaggaggag
tatgccccagtgcatatgttctcactgtctgagaacgcggcgaacaagatgctgaagttt
gggatgatggacttggtgaagcacacgcgaacgcatatggtcaggatctaccccaagggc
acgagagtgagttcgacgaactatgagcctcatcgattctggtgtgctggtgcccagctt
gttgcgatgaattggcaaacgtttgatttgggatatatgattaatcacgccatgttccag
cggaacggacgatctggatttgtgttgaagcctcttgcgcttcgtataggatccaaggac
cttctttcaaagcgcacacaacaccgcttcgacgtcactattatctctgcacaacagcta
cccaggccaaaaaacgcctcagggcacgagattatggacaagtctgttatcgatccatat
gtccaggtgacgatacacgtccctgactggccttgggcggctcccgttcacggtagtgcg
cgaaaaccgattcctggggaactggcttctccttctcagatgacaactggagctgggggt
ttaggatccccatctacgcctcgtcgatcgatatcgtgcagaacgaatgctgtgaagaat
aatgggtttaacccggtgtgggaggagaagttgaggataccgtttgagtgtgtgggtgat
atgatggatttggtttttgtgaggtttgtggttagacggcaggaggataaggatcaggag
gagcctcttgcggtgtattgtgctccgctcgggagcttagagcatggttatcgacatctt
ccactgcatgattcgcaactgtcccagtacctgttttcgacgctattcgtcaagatcaac
gttactatggtagaagtatga

DBGET integrated database retrieval system