KEGG   Laccaria bicolor: LACBIDRAFT_315547Help
Entry
LACBIDRAFT_315547 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lbc  Laccaria bicolor
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LACBIDRAFT_315547
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LACBIDRAFT_315547
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LACBIDRAFT_315547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1046 aa AA seqDB search
MEDPSRMLRRAGNLLTSNGQPVKELDVDSDVPRLPGSPPPRSHKLGLGASIKRRLQEVVG
GSTARSRSVGGLGRSPRTPAPSTDTGNGEVGRSHARSFSDIPTAQAPIFDRPTPSTAQAP
ALSNKRHSVGAQPSSVPEVSNLSGEQEVTSPVSEQQPTASSSASQLEDVLVPQLLQQGTP
MTKVSAKKHKKFVFRLDADLGQIVWESVSKQQKIIPIENIKEIRTGSDARYYRQQFQLAQ
EYEDRWLTIVYILDGAYKTLHLIVATKDVFQIWNKTLRELHAIRQELMRGIGNIEVREAL
WERQHWKGAGEERDQKLTFEEVVRLCRRLNIHSNQEDLFRLFTRADTQQRGFLDFDDFRR
FVKLLKGRPEIDRLYKKLKVDSGGVFVFATFEKFMRDKQKSTLSQDELQAVFDKYTKNTD
SATTMNVDSFTSFLLSPDNCAFSDQHSKVFHDMTRPLSEYFISSSHNTYLVGHQLIGDST
IEGYIRALLHSCRSVELDIFDGDHEPMIFHGKTLTTKVSLREVCQVIKKYGFVASPYPII
LSAEVHCSVAQQDMIAAIMIEVFEDTLIQEPLEELAEGRRIEVLPSPEQLKGKILLKTKN
LLLQGPDPVVGGDVFFSDVSASSTSDSEAWVDATQDPSAVFNGRKRRSESDSVKDQLRKA
RSTVLKRVQSVGKASSSSASSSTTPRRARSPAPSSPHLPAIPISPVPIETTLKPPNTISA
RRPSDTSELSRPKPKMSPALVALLVYTVGVKCRGINKKEEYAPVHMFSLSENAANKMLKF
GMMDLVKHTRTHMVRIYPKGTRVSSTNYEPHRFWCAGAQLVAMNWQTFDLGYMINHAMFQ
RNGRSGFVLKPLALRIGSKDLLSKRTQHRFDVTIISAQQLPRPKNASGHEIMDKSVIDPY
VQVTIHVPDWPWAAPVHGSARKPIPGELASPSQMTTGAGGLGSPSTPRRSISCRTNAVKN
NGFNPVWEEKLRIPFECVGDMMDLVFVRFVVRRQEDKDQEEPLAVYCAPLGSLEHGYRHL
PLHDSQLSQYLFSTLFVKINVTMVEV
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggaagatccaagtcgtatgctacgccgtgcgggcaatctcctcacgagcaacggccaa
ccagtaaaagagctcgatgtcgactccgacgtgcccaggcttccgggatcaccgccaccc
cgaagtcacaaactaggactaggcgcctccattaaacgacggctgcaggaggttgttggg
ggatctaccgcgcggtcacgatctgttggcggtcttgggcgttcaccacgaacgccggcg
ccttcgaccgatactgggaacggagaggttggcagaagtcatgcgcgctcattttccgat
atacccactgcccaggcgcccatttttgaccgtccgacacctagtactgcccaggctccc
gccctttccaataagcgccattctgtgggcgcgcaaccgtcaagtgtcccagaggtgtct
aacttgagtggggagcaggaagttacgtctcccgtgtcagagcagcagcctaccgcgtcc
tcgtccgcttctcagctggaagatgtgttggttccgcagttgttgcagcagggcacaccc
atgaccaaggtgtccgcgaagaagcacaaaaagtttgtgtttcgcttagacgcggatttg
gggcagatcgtgtgggagtctgtgtcgaagcagcagaagattataccgattgagaatatc
aaggaaattcggacggggtcggacgcgcggtattataggcagcaattccagctcgcacag
gaatatgaagatcggtggcttacgattgtctatatccttgatggcgcgtataagacgcta
catctcatcgtggcaaccaaggacgtgttccagatatggaataagactttgcgcgagtta
catgcaattcggcaggagctcatgcgcggaattgggaatattgaagtgagggaagctttg
tgggagagacagcattggaagggggcgggcgaggagagggatcagaagctgacgtttgaa
gaggttgttaggctttgtaggaggctgaacatccattcgaaccaggaagatctgtttaga
cttttcactcgggcagacacgcagcaacgcggatttctggactttgatgatttccggagg
tttgtcaagctgctcaagggaagaccggaaattgatcggttgtataagaaactcaaggtg
gatagtgggggtgtttttgttttcgcaacgttcgaaaagttcatgcgggacaagcagaag
tccacactcagtcaagacgagctccaggccgtctttgacaagtataccaagaataccgac
tcagcaacaaccatgaatgtcgactcgttcacctccttcctcctatccccggacaactgc
gctttttcggatcagcattccaaggtcttccatgacatgacgcgccctctatcagagtac
tttatctcctcatctcacaacacctacctagtcggacatcagctgatcggcgatagcacg
attgaaggctacatccgagcccttttgcacagttgcaggagtgtagaactggacatcttc
gacggcgaccatgagcctatgatcttccatggcaagacactcaccaccaaggtgtccctc
cgggaagtttgccaggtgatcaagaaatatgggtttgtcgcctcgccttatccaatcatt
ctgtccgcggaagttcactgctcggtggcccagcaagatatgattgctgcgatcatgatc
gaggtgtttgaggacactttgattcaggaaccactagaggagctggcggaggggcggagg
attgaggtgcttccgagccccgaacagttgaaggggaagatattattgaagacgaagaac
ctcttgcttcaagggccagatcctgttgtgggcggtgatgtctttttctctgatgtttct
gcgtcttcaacatcagattcggaggcttgggtagacgcaacgcaggacccttcggcggta
tttaatggacgcaaacggaggagtgaatcggacagtgtcaaagatcagctccgcaaagct
cgaagtaccgttttgaagcgggttcaaagtgtgggcaaagcgtcttcatcgtccgcctct
tcgtccaccaccccacgacgagcacgttccccagcaccatcatcccctcatcttcccgca
atccccatttctcccgttccgatcgagactactttgaaacccccaaacacaatttccgcc
agacgcccatctgatacatctgaactttcccgaccgaaacccaaaatgtcgccagcactt
gtggcattgctggtatacactgtcggtgtcaaatgtcgcggaattaacaagaaggaggag
tatgccccagtgcatatgttctcactgtctgagaacgcggcgaacaagatgctgaagttt
gggatgatggacttggtgaagcacacgcgaacgcatatggtcaggatctaccccaagggc
acgagagtgagttcgacgaactatgagcctcatcgattctggtgtgctggtgcccagctt
gttgcgatgaattggcaaacgtttgatttgggatatatgattaatcacgccatgttccag
cggaacggacgatctggatttgtgttgaagcctcttgcgcttcgtataggatccaaggac
cttctttcaaagcgcacacaacaccgcttcgacgtcactattatctctgcacaacagcta
cccaggccaaaaaacgcctcagggcacgagattatggacaagtctgttatcgatccatat
gtccaggtgacgatacacgtccctgactggccttgggcggctcccgttcacggtagtgcg
cgaaaaccgattcctggggaactggcttctccttctcagatgacaactggagctgggggt
ttaggatccccatctacgcctcgtcgatcgatatcgtgcagaacgaatgctgtgaagaat
aatgggtttaacccggtgtgggaggagaagttgaggataccgtttgagtgtgtgggtgat
atgatggatttggtttttgtgaggtttgtggttagacggcaggaggataaggatcaggag
gagcctcttgcggtgtattgtgctccgctcgggagcttagagcatggttatcgacatctt
ccactgcatgattcgcaactgtcccagtacctgttttcgacgctattcgtcaagatcaac
gttactatggtagaagtatga

DBGET integrated database retrieval system