KEGG   Laccaria bicolor: LACBIDRAFT_315670Help
Entry
LACBIDRAFT_315670 CDS       T01044                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lbc  Laccaria bicolor
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lbc00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 482 aa AA seqDB search
MTRSRMGGPPCTIVIKLGTSSIVHETTHQPLLSTLSSIVETVVQLKRQGHKVVLVSSGAI
GVGLKRMDMLNRPKSLSGKQALAAIGQGRLIALWDNLFGQLEQPIAQVLLTRGDISDRTR
YLNAVNTFKELLSMGVVPIVNENDTVSVSEIKFGDNDTLSAITSSMIHADYLFLLTDVDG
LYTSNPRKDPSAKQIEVVNSISAIRLEVSTTTLGSSLGTGGMETKLIAAEIATAAGVTTI
ITSSKRPENIFSIIEYHARYSPMTRPLSASTASLPSPGHDTSGPQHQQYSSSTPSSGTSS
PAPLPRPPHTLFTASPTPMRDLKSWTSHTLFPSGSVIIDAGAHYVLSKRESGGRLLAAGV
VGVVGAFASGQAVRIVIRRHGGQQEDERKAYARALEITRPNTPTQWSSEVSEDDLTPAQR
EEEVAHVEEDILEVGRGLANYNSAQIVRVKGLNSSHLSQVLGYADSEYVVENITIRVPPS
VS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctcacgcatgggaggaccaccatgcaccatcgtgatcaagcttggaacctct
tccatcgttcatgaaacgacacatcagccactgttgtcgaccttgtcttccatcgtggaa
actgttgtgcaactcaagagacaggggcacaaagtcgtcctcgtgagctctggcgccatt
ggggtcggattaaagcgcatggacatgctcaatcgaccaaagagtctttctgggaagcag
gcattggcagcgattgggcaaggaagattaatcgcattatgggataacctcttcgggcaa
ttggagcagccgatagcacaagttctcttgacgagaggcgacatctcggatcgaacgcgg
tatctcaacgccgtcaacaccttcaaagaattactctcgatgggtgtcgtcccaatcgtt
aacgagaacgacacggtctccgtcagcgaaatcaaatttggagataatgataccctttct
gccataacctcttcaatgattcatgcggactacctctttcttctgacggacgtggacggg
ctctatacatcgaatccacgaaaagatccttctgcgaagcagatcgaggtagtgaattcg
atatctgccatacgtttggaagttagtaccacgacgctcggctccagccttgggactgga
gggatggagacaaaactcattgcagctgaaatcgccacggcagctggtgtaacgaccatt
attacctcaagcaaaagaccagaaaatatcttcagcatcatcgaataccacgcacgatat
tctcccatgacacggccactctctgcttcaacggcttctctcccttcgccaggtcatgat
acctctggtccccaacaccaacaatatagctccagcacaccatctagcggcacctcttcc
cctgctccccttccacgtcctccacacactttatttacggcgtcaccaacgcccatgcga
gatctaaaatcatggactagccacacgctgttcccatccggtagcgtgatcatcgacgca
ggtgcacattacgtcctgtcaaaacgtgaatcgggtggcaggttgctcgcggcaggcgtg
gtgggtgtcgtaggcgcatttgcttctggtcaggctgtgagaattgtcattcgtcgccat
ggagggcagcaggaagatgagaggaaagcatacgcacgggcgcttgagatcacccgcccg
aatacgcccactcaatggagcagtgaggtttcggaagatgacttgacacctgcccaacgc
gaggaagaggtcgcacatgtagaggaagacatactagaggttgggaggggtttagcaaac
tacaactcggcgcagattgtcagagtgaaaggattgaatagctcacatctttctcaggtg
cttggttatgcagattcagagtatgtcgtagagaacatcaccatccgcgtcccgccttcg
gtttcttga

DBGET integrated database retrieval system