KEGG   Laccaria bicolor: LACBIDRAFT_315670Help
Entry
LACBIDRAFT_315670 CDS       T01044                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lbc  Laccaria bicolor
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACBIDRAFT_315670
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LACBIDRAFT_315670
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LACBIDRAFT_315670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 482 aa AA seqDB search
MTRSRMGGPPCTIVIKLGTSSIVHETTHQPLLSTLSSIVETVVQLKRQGHKVVLVSSGAI
GVGLKRMDMLNRPKSLSGKQALAAIGQGRLIALWDNLFGQLEQPIAQVLLTRGDISDRTR
YLNAVNTFKELLSMGVVPIVNENDTVSVSEIKFGDNDTLSAITSSMIHADYLFLLTDVDG
LYTSNPRKDPSAKQIEVVNSISAIRLEVSTTTLGSSLGTGGMETKLIAAEIATAAGVTTI
ITSSKRPENIFSIIEYHARYSPMTRPLSASTASLPSPGHDTSGPQHQQYSSSTPSSGTSS
PAPLPRPPHTLFTASPTPMRDLKSWTSHTLFPSGSVIIDAGAHYVLSKRESGGRLLAAGV
VGVVGAFASGQAVRIVIRRHGGQQEDERKAYARALEITRPNTPTQWSSEVSEDDLTPAQR
EEEVAHVEEDILEVGRGLANYNSAQIVRVKGLNSSHLSQVLGYADSEYVVENITIRVPPS
VS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctcacgcatgggaggaccaccatgcaccatcgtgatcaagcttggaacctct
tccatcgttcatgaaacgacacatcagccactgttgtcgaccttgtcttccatcgtggaa
actgttgtgcaactcaagagacaggggcacaaagtcgtcctcgtgagctctggcgccatt
ggggtcggattaaagcgcatggacatgctcaatcgaccaaagagtctttctgggaagcag
gcattggcagcgattgggcaaggaagattaatcgcattatgggataacctcttcgggcaa
ttggagcagccgatagcacaagttctcttgacgagaggcgacatctcggatcgaacgcgg
tatctcaacgccgtcaacaccttcaaagaattactctcgatgggtgtcgtcccaatcgtt
aacgagaacgacacggtctccgtcagcgaaatcaaatttggagataatgataccctttct
gccataacctcttcaatgattcatgcggactacctctttcttctgacggacgtggacggg
ctctatacatcgaatccacgaaaagatccttctgcgaagcagatcgaggtagtgaattcg
atatctgccatacgtttggaagttagtaccacgacgctcggctccagccttgggactgga
gggatggagacaaaactcattgcagctgaaatcgccacggcagctggtgtaacgaccatt
attacctcaagcaaaagaccagaaaatatcttcagcatcatcgaataccacgcacgatat
tctcccatgacacggccactctctgcttcaacggcttctctcccttcgccaggtcatgat
acctctggtccccaacaccaacaatatagctccagcacaccatctagcggcacctcttcc
cctgctccccttccacgtcctccacacactttatttacggcgtcaccaacgcccatgcga
gatctaaaatcatggactagccacacgctgttcccatccggtagcgtgatcatcgacgca
ggtgcacattacgtcctgtcaaaacgtgaatcgggtggcaggttgctcgcggcaggcgtg
gtgggtgtcgtaggcgcatttgcttctggtcaggctgtgagaattgtcattcgtcgccat
ggagggcagcaggaagatgagaggaaagcatacgcacgggcgcttgagatcacccgcccg
aatacgcccactcaatggagcagtgaggtttcggaagatgacttgacacctgcccaacgc
gaggaagaggtcgcacatgtagaggaagacatactagaggttgggaggggtttagcaaac
tacaactcggcgcagattgtcagagtgaaaggattgaatagctcacatctttctcaggtg
cttggttatgcagattcagagtatgtcgtagagaacatcaccatccgcgtcccgccttcg
gtttcttga

DBGET integrated database retrieval system