KEGG   Laccaria bicolor: LACBIDRAFT_315993Help
Entry
LACBIDRAFT_315993 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
lbc  Laccaria bicolor
Pathway
lbc04111  Cell cycle - yeast
lbc04113  Meiosis - yeast
lbc04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    LACBIDRAFT_315993
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    LACBIDRAFT_315993
   04113 Meiosis - yeast
    LACBIDRAFT_315993
Protein phosphatases and associated proteins [BR:lbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LACBIDRAFT_315993
Ubiquitin system [BR:lbc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     LACBIDRAFT_315993
Chromosome and associated proteins [BR:lbc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    LACBIDRAFT_315993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_19 TPR_17 TPR_16 TPR_8 TPR_11 TPR_14 TPR_12 TPR_6 TPR_20 TPR_15 TPR_9 PPTA Lipase TPR_10
Motif
Other DBs
NCBI-GeneID: 6073985
NCBI-ProteinID: XP_001878258
JGI: 315993
UniProt: B0D3N6
AA seq 793 aa AA seqDB search
MQSEPLPSFFPNLSQRFQSLVWSCLDSDLTKTAVFHAERYYAMDPNNHQARHLYATALLR
EGQTYSALYLVNNAQDFQCTGCLEIKAKSCTALGRHRQAREALEATMLDTNYVSGASSSS
RVSRPFPEDAALRCRSGTMALKGNLPEMASRSFRGALASNPYIWEAFEGLCALGSIPEID
EIFPSRPPPVKRLPPEETQAKSIPIASGAGFFTPDAGNAGNLFRTWKPDISQPQPFRMPP
PGPRDSLLSNDTFLPDNSIQVHRTSRSQPTVSNPIQAPAPRPLSSADEAGPVPKRLRSTT
RQPEAVKPKPSKSSLDDPLKKARARPALSFANIFSSSDGRSQPTTSSRTNLGPGKSSAQT
SHIPTRRSTRLLSGTGPKLPHTSKNPATRDRDRRRQAAQPRNKSIESERDEELAPIGEVA
HSRSPPSAALSHRSEVSPSPSNWTAAHEQQAQEEYEGELAEYYLYNLIRRFASAARALAM
YDCRTCLAELGQLPHVHQNSAWVLSMVGRVHYEKQDYASAERAFKAVRALEPHRLWDMEV
YSTLLWHLQRNVELSFLAQELLNINPQSPQAWIAIGNLFSLQKERLQALTCFRRAGQLDP
TCAYAFTLSGHESIDEDLEKAINFFQSALRADPRHYNAWYGLGTCYLRMSKIRLAEYHYR
KAVEIHPNNAVLLGCVGMAVDRRGDRDAALALFDEAVRLAPDNALVRYRRAKILVSMRKY
ERAVEDLVSLRNSTPEESNVVFQLAKVYRLLGDEVNSAKTLALARDISPKSMNKIKKLLD
TVKDEGDEPMDEG
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcggaaccactcccctcattcttccctaacctctcccaacgctttcagtctctc
gtatggtcgtgtctagactcggatctgactaagactgctgtctttcatgcggagagatac
tacgcgatggatccaaataaccaccaggcgcggcatctttatgcgacggctctcctgcgc
gaaggccaaacgtactcggctttgtacctcgtgaacaatgcacaagatttccaatgtact
ggatgtttggaaatcaaagccaagtcgtgtacggcactgggtcgccacaggcaggcgcgt
gaggctctggaagctacaatgctcgacacaaactacgtgtctggagcctcttcgagcagc
agagtgtcgcgaccatttcctgaagacgcagccttgcgatgtagatctggcacgatggcc
cttaaaggtaaccttccggaaatggcgtcgcgtagctttcggggcgctctggcgtcgaat
ccgtatatctgggaggcgttcgagggtctatgtgctttggggtcaataccggagattgat
gaaatatttccctcacggccaccacccgtaaaacgtcttccaccagaagagacgcaggcc
aagtcgatacctattgcttctggcgcaggattcttcacaccagacgctggcaatgctggt
aatctttttcggacgtggaaacctgatatatcacaaccccagccatttcgcatgcctcca
ccggggcctcgagactcgctgctgtctaacgatacattcctccctgacaactccatacaa
gtacatcgaactagtcgatcgcaaccgacagtttctaatccaatccaagcacccgcccct
cgaccgctttcctcagctgatgaagcgggcccagtgccgaagaggttgcggtcgacgacg
cggcagcccgaagcggtcaaaccgaaaccgagcaaatcgagtctcgacgaccccttgaaa
aaggcacgcgcacgcccggccttgtcatttgctaacatcttctcatcttccgatggtcgt
tctcagccaacgacttcctctaggacaaatcttggccctgggaagagcagcgctcaaact
agtcatatccccacacgacggagtacccgtttgttgagtggtacgggacccaagttgccc
catacttccaagaatcctgccacgagagatcgtgatcgtcggcgacaagccgctcagcca
cgcaacaaatcgatagagtccgaaagagatgaggaattggcccccattggcgaggttgca
cactcaaggtcgcccccttctgctgcactttcacatcgctccgaagtatccccttcaccg
agcaactggactgcggcacatgaacagcaagcgcaggaggagtatgaaggcgaacttgcc
gagtattatttgtacaacttgattcgacgatttgccagcgcggcaagggctttagcaatg
tacgattgccgaacttgcctagcagagttgggacagctgcctcacgtccatcaaaattca
gcctgggtgctgtcgatggtgggcagagtgcattatgaaaagcaagattacgcttctgct
gagcgagctttcaaagctgtaagggcattagaacctcatcgtctatgggacatggaggtc
tattcaactttgttgtggcacttgcagcgcaatgtcgaactatcattccttgcccaagaa
ctgctgaacatcaatcctcagtcgcctcaagcttggatagccattggaaatttattttct
ttgcaaaaagagcggctacaggctttaacgtgcttccgccgagctggtcaactcgatccc
acctgcgcttacgcgtttacgctaagtgggcacgaatcgatagatgaagaccttgaaaag
gccatcaacttcttccaatctgcgttacgtgcagaccctcgtcactataatgcatggtac
ggattgggtacgtgttacctgaggatgagtaaaatacgcctagcggagtatcattacaga
aaggcggttgagatccacccgaacaatgcggttttgctagggtgtgttggaatggctgtt
gaccgacgtggggaccgcgacgcagccctggccctctttgacgaagctgtccggcttgca
cccgataacgccctagttcgttatcggagagccaaaattctggtctcaatgaggaaatat
gagcgggccgttgaagacttggtgtcactgcggaacagtacgccagaagagtcaaatgtc
gtcttccagttggccaaggtctaccggctgctcggagatgaagtgaactctgcaaagacg
cttgcgcttgcacgggacatttcaccgaagagcatgaacaagatcaagaagttgttggac
actgtgaaagatgaaggagatgagccaatggatgaaggatga

DBGET integrated database retrieval system