KEGG   Laccaria bicolor: LACBIDRAFT_315993Help
Entry
LACBIDRAFT_315993 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
lbc  Laccaria bicolor
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    LACBIDRAFT_315993
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    LACBIDRAFT_315993
   04113 Meiosis - yeast
    LACBIDRAFT_315993
Protein phosphatases and associated proteins [BR:lbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LACBIDRAFT_315993
Ubiquitin system [BR:lbc04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     LACBIDRAFT_315993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 793 aa AA seqDB search
MQSEPLPSFFPNLSQRFQSLVWSCLDSDLTKTAVFHAERYYAMDPNNHQARHLYATALLR
EGQTYSALYLVNNAQDFQCTGCLEIKAKSCTALGRHRQAREALEATMLDTNYVSGASSSS
RVSRPFPEDAALRCRSGTMALKGNLPEMASRSFRGALASNPYIWEAFEGLCALGSIPEID
EIFPSRPPPVKRLPPEETQAKSIPIASGAGFFTPDAGNAGNLFRTWKPDISQPQPFRMPP
PGPRDSLLSNDTFLPDNSIQVHRTSRSQPTVSNPIQAPAPRPLSSADEAGPVPKRLRSTT
RQPEAVKPKPSKSSLDDPLKKARARPALSFANIFSSSDGRSQPTTSSRTNLGPGKSSAQT
SHIPTRRSTRLLSGTGPKLPHTSKNPATRDRDRRRQAAQPRNKSIESERDEELAPIGEVA
HSRSPPSAALSHRSEVSPSPSNWTAAHEQQAQEEYEGELAEYYLYNLIRRFASAARALAM
YDCRTCLAELGQLPHVHQNSAWVLSMVGRVHYEKQDYASAERAFKAVRALEPHRLWDMEV
YSTLLWHLQRNVELSFLAQELLNINPQSPQAWIAIGNLFSLQKERLQALTCFRRAGQLDP
TCAYAFTLSGHESIDEDLEKAINFFQSALRADPRHYNAWYGLGTCYLRMSKIRLAEYHYR
KAVEIHPNNAVLLGCVGMAVDRRGDRDAALALFDEAVRLAPDNALVRYRRAKILVSMRKY
ERAVEDLVSLRNSTPEESNVVFQLAKVYRLLGDEVNSAKTLALARDISPKSMNKIKKLLD
TVKDEGDEPMDEG
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcggaaccactcccctcattcttccctaacctctcccaacgctttcagtctctc
gtatggtcgtgtctagactcggatctgactaagactgctgtctttcatgcggagagatac
tacgcgatggatccaaataaccaccaggcgcggcatctttatgcgacggctctcctgcgc
gaaggccaaacgtactcggctttgtacctcgtgaacaatgcacaagatttccaatgtact
ggatgtttggaaatcaaagccaagtcgtgtacggcactgggtcgccacaggcaggcgcgt
gaggctctggaagctacaatgctcgacacaaactacgtgtctggagcctcttcgagcagc
agagtgtcgcgaccatttcctgaagacgcagccttgcgatgtagatctggcacgatggcc
cttaaaggtaaccttccggaaatggcgtcgcgtagctttcggggcgctctggcgtcgaat
ccgtatatctgggaggcgttcgagggtctatgtgctttggggtcaataccggagattgat
gaaatatttccctcacggccaccacccgtaaaacgtcttccaccagaagagacgcaggcc
aagtcgatacctattgcttctggcgcaggattcttcacaccagacgctggcaatgctggt
aatctttttcggacgtggaaacctgatatatcacaaccccagccatttcgcatgcctcca
ccggggcctcgagactcgctgctgtctaacgatacattcctccctgacaactccatacaa
gtacatcgaactagtcgatcgcaaccgacagtttctaatccaatccaagcacccgcccct
cgaccgctttcctcagctgatgaagcgggcccagtgccgaagaggttgcggtcgacgacg
cggcagcccgaagcggtcaaaccgaaaccgagcaaatcgagtctcgacgaccccttgaaa
aaggcacgcgcacgcccggccttgtcatttgctaacatcttctcatcttccgatggtcgt
tctcagccaacgacttcctctaggacaaatcttggccctgggaagagcagcgctcaaact
agtcatatccccacacgacggagtacccgtttgttgagtggtacgggacccaagttgccc
catacttccaagaatcctgccacgagagatcgtgatcgtcggcgacaagccgctcagcca
cgcaacaaatcgatagagtccgaaagagatgaggaattggcccccattggcgaggttgca
cactcaaggtcgcccccttctgctgcactttcacatcgctccgaagtatccccttcaccg
agcaactggactgcggcacatgaacagcaagcgcaggaggagtatgaaggcgaacttgcc
gagtattatttgtacaacttgattcgacgatttgccagcgcggcaagggctttagcaatg
tacgattgccgaacttgcctagcagagttgggacagctgcctcacgtccatcaaaattca
gcctgggtgctgtcgatggtgggcagagtgcattatgaaaagcaagattacgcttctgct
gagcgagctttcaaagctgtaagggcattagaacctcatcgtctatgggacatggaggtc
tattcaactttgttgtggcacttgcagcgcaatgtcgaactatcattccttgcccaagaa
ctgctgaacatcaatcctcagtcgcctcaagcttggatagccattggaaatttattttct
ttgcaaaaagagcggctacaggctttaacgtgcttccgccgagctggtcaactcgatccc
acctgcgcttacgcgtttacgctaagtgggcacgaatcgatagatgaagaccttgaaaag
gccatcaacttcttccaatctgcgttacgtgcagaccctcgtcactataatgcatggtac
ggattgggtacgtgttacctgaggatgagtaaaatacgcctagcggagtatcattacaga
aaggcggttgagatccacccgaacaatgcggttttgctagggtgtgttggaatggctgtt
gaccgacgtggggaccgcgacgcagccctggccctctttgacgaagctgtccggcttgca
cccgataacgccctagttcgttatcggagagccaaaattctggtctcaatgaggaaatat
gagcgggccgttgaagacttggtgtcactgcggaacagtacgccagaagagtcaaatgtc
gtcttccagttggccaaggtctaccggctgctcggagatgaagtgaactctgcaaagacg
cttgcgcttgcacgggacatttcaccgaagagcatgaacaagatcaagaagttgttggac
actgtgaaagatgaaggagatgagccaatggatgaaggatga

DBGET integrated database retrieval system