KEGG   Laccaria bicolor: LACBIDRAFT_316459Help
Entry
LACBIDRAFT_316459 CDS       T01044                                 

Gene name
HDA16207
Definition
histone deacetylase complex protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
lbc  Laccaria bicolor
Brite
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LACBIDRAFT_316459 (HDA16207)
Protein phosphatases and associated proteins [BR:lbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LACBIDRAFT_316459 (HDA16207)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 705 aa AA seqDB search
MEAYEAGPSEAMDVDQQPAQTNGEFPAPVQRGPRALSVPMKHPGLTVGFVYSTEMMAHFS
PQGHPERPARIDRIWNTLQNDQLTQNMKWLPIRPVRKEEALLVHSDDHWDKVIAIQYMSD
QQLADSEEYYEQMSLYVMSGTTRAALLSCGGVIESCLAVARGELKKTFAIVRPPGHHAEP
DEHMGFCFFNNVAVAARVVQQLTKIKKIMILDWDVHHGNGTQRAFNEDNSVLYVSIHRYE
QGTYYPCGPFGGMQSCGEGPGLGFSVNVPWPEAGMGDADYLHAFQKVVMPIAMEFAPELV
ISKCHFFCFNVAIAKPPTVYIVSAGFDAAAGDDLGECFVSPAGYAHMTHMLSGLAGGRLV
VALEGGYNLDSISNSALAVARILMGQAPDELPPLVASEAATETVWLVAREQSKYWKSVDP
KSCEPQEGLEDITFSIPEILKAHRQHYLYTQYDMMQVPLISAELEQRFSSQIMCTSDIFE
NKTLIVFVHEFGNLRLELASSATCDVHLERSHLIDFSKKLVTWVKKEGYALLDANLYPKP
SQAPVTRGNKNPQDIGRDIITYLWDNYIQLSSATRVVFIGHGPGCQPLVELVDRRALSVI
KSVKAFVQIVGPQIQPTAPQPSSDEIRAWYKKHSLVILPENHPFIGPSAKSFNLKRHGTL
VPIQESQQVKMVIQALPGVQEFVRENLQRYPLSDTTHTNNLARPY
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctatgaagcaggtccttcggaagcaatggatgtggaccagcaacccgcccaa
actaacggagaatttcctgcaccggtccagcgtggacctcgtgcattatcggtccccatg
aagcaccccggccttaccgtcggctttgtatactctacagaaatgatggcccatttctct
ccacaaggtcatccagaacggccagctcgcatagatcggatatggaatacattacaaaac
gaccaacttactcaaaatatgaagtggttgccaatccggcccgttcgtaaagaggaagct
ttacttgtacatagcgacgatcattgggacaaagttatcgcaattcaatacatgtccgat
cagcaactcgccgattctgaggaatactatgaacaaatgtcattgtatgttatgtctgga
accactcgcgctgctctattaagctgtggtggggtgattgaatcatgtttggctgtcgcc
agaggtgaattaaagaagacatttgctatcgtacggccaccaggccaccatgctgaaccc
gatgagcatatgggcttctgtttctttaacaacgtcgctgtagccgctagagtcgtgcaa
cagctaacgaagataaagaaaattatgattctcgactgggatgttcatcacggcaatggt
actcaaagggcattcaacgaagataacagcgttctctacgtttcaatacatcggtatgag
caaggtacttactacccatgtggtcctttcggtggaatgcagtcgtgcggcgagggcccc
ggcctcgggttctcagtcaacgtaccatggcctgaagcgggcatgggagacgccgactac
cttcatgcctttcagaaagttgttatgccgattgcgatggagtttgctcctgaactggtg
ataagcaagtgtcatttcttttgcttcaacgtcgcgatcgctaaaccgcccactgtatat
atagtctctgcaggcttcgacgcagctgctggcgacgaccttggagagtgcttcgtttct
cctgcggggtacgcacatatgacgcatatgctgtctggattggctggcggtcggttagtt
gtcgccttggagggtggatacaacttggactcaatatcgaattctgccttagctgttgca
agaattctgatggggcaagctcccgacgagcttccgcctctcgttgcatctgaagccgca
acggaaaccgtttggctagtcgccagggagcagagcaagtattggaagagcgttgatcca
aaatcatgcgagcctcaggaaggcctagaagacataaccttctcgataccagaaatcctc
aaagcacacaggcaacactacctatatacccagtatgacatgatgcaagtccctttgatt
agtgcggaactcgagcagcgcttctcttcacaaatcatgtgcacgtcagatatattcgaa
aacaaaacactaatagtctttgttcacgaatttggtaatctgcgactagaattagcgtca
tccgccacttgcgatgtccacctagagcgctcccacttgattgatttctcaaaaaagctt
gtgacatgggtgaaaaaagagggttatgcgttgcttgacgcaaacttatatccaaaaccg
agccaagcgcctgtcacaagaggaaataaaaatccgcaagacatcgggagagatatcatt
acatatttatgggacaattacattcagctttccagcgcgactcgggtggtatttattggt
cacggtcctggttgtcaacctttggttgaactcgttgaccgacgggctctatctgttatt
aagtcggtgaaggcatttgttcaaatcgtcggaccccaaatacaacctacggcacctcaa
ccgtcatctgatgagatccgcgcttggtataaaaagcactctcttgtgattttgccagag
aatcaccccttcattggcccctccgccaagtcattcaacttaaaacgacacgggactttg
gttccgatacaggagtcccagcaagtcaagatggtcatccaagccctccccggagtccag
gagtttgtaagggaaaacttgcagcggtacccattatccgacacgacacatacgaataat
ctcgccaggccttactag

DBGET integrated database retrieval system