KEGG   Laccaria bicolor: LACBIDRAFT_318032Help
Entry
LACBIDRAFT_318032 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
lbc  Laccaria bicolor
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:lbc03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 261 aa AA seqDB search
MSDWEGSDSDTAPVVKGKPAAPAKPSAAKPIKSKWEGEDKEEEGPVSDWEESSEEESEEE
AKPAPVAPPKKKGTLKQKLAEKEAEKALRQANGENSDEYDSDAVLDPREKARRDKEKELN
ADLNNAAELFGAAALGGTSSAELDALISAQPRTKEDFQKLSASIIEFIVKRHEAKPLYPS
FVEHFARAVALPLKDVEVRKVASGLMTLANEKQKEQRDKASGKKKPKAASKPGLGGAKVS
SRLDTGAYEEALDDFGNDDFM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactgggaaggatcagacagcgacaccgcgccagtggtcaagggcaaacctgca
gcacctgcaaagccttctgctgcgaagcctataaaatcgaaatgggaaggagaagataaa
gaggaggaagggcctgtgagcgactgggaagaatcgtccgaggaagagtcggaggaagaa
gccaaacccgcgccagtcgccccaccgaagaaaaagggcaccctcaagcagaaattggca
gaaaaagaagcggagaaagctctgcggcaagctaatggcgaaaattccgacgaatacgac
tcggatgcagttcttgaccctcgggaaaaggcaaggagggataaagagaaggagctcaac
gccgacctgaataatgctgcggaactgtttggtgcagctgctcttgggggaacatcctct
gcagaacttgacgctctaatatctgcgcaaccacggacaaaagaggacttccagaagctc
tcggcgagcatcatcgagttcatcgttaagcggcacgaagctaagccgttgtacccatcg
tttgtggagcactttgcgagggcggtcgcactgccgctgaaagatgtggaggtccgcaag
gtcgcgtcggggttgatgacgctggcgaatgagaaacagaaggagcagagggataaggcg
agtgggaagaagaagccaaaggcggcgtcgaagccagggttaggtggggcgaaagtgtcg
tcacggcttgatacaggcgcttacgaggaagctttggatgactttggaaacgacgatttc
atgtaa

DBGET integrated database retrieval system