KEGG   Laccaria bicolor: LACBIDRAFT_318182Help
Entry
LACBIDRAFT_318182 CDS       T01044                                 

Definition
hypothetical protein
Organism
lbc  Laccaria bicolor
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 780 aa AA seqDB search
MTSVPPPSSTAPLVSSALNVPTATSYPSVNCLQWSSDGQLCFVTKTAIYILTPDHGINFD
NTSVIKSSLNKESREDSQALGWFRTIIQFDKSEGIRWPDHSQAWGAASLGSIDLSPSSVA
ISPSGLSSDGGCVLAMLSSNMDLTLWVAGKNYLKGEWPKAADVTPFLLETHPSEDILKSQ
VISVAWTPFANFNVCPTPLVNSSFLVIGSRAGSITLLRYHAHKEIEHIHTISVADRWITQ
LAPSAWSLASPGVCEGYIAYGSADGSVGLIKITQVLQETDGEFHFAQNFVLEVTVERGPE
LLFGPDKTGITALIWVDIVGRAHSGRLQTWNRAPLDCSWRRIRLDGISFSLNQDTKDIRS
LIRIPISVGNCLPSATRHTRVILSDGSFHTIHNLSKDPSWTSQKEDDQITSDNLSKTSRS
VFVKAEQGAVDQNDMNRITGTISYDDHATFLWAYETANPSDFSYKHDAKHSSMLIAAQMW
EDDEDDVLLRGLANTLNGVRTAIGSEPLHVLRPYLFHLRNQRKLASLHPHFLEILKPTFA
DHSVDIHIPQCTGEMTPELRRDFRTSLSRHLFGWDVLLSLRMRLSLADFAWKLSISPEQQ
ADCGHVAQGLLNTISHRVLRTIIRHLASVTNCLQPNDVPFALRMVVQSLLPGSPPDLSQE
GRDLAALVEGLTSNPSSPISNELNEVCPACKVEVPLQDITTAVCPNGHTWARCSITTFIL
STPRVRTCVGCSRKAFLPVSAPNSPDHSWLPPTARGWVVEELLEAVHRCLFCNNSFVSVL
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgttccgccaccttcctccacggcaccgcttgtctccagcgcgctcaatgtc
ccaacggctacttcctacccctctgtgaattgcctccagtggtcttctgatgggcaacta
tgtttcgtgacaaaaaccgcgatttacatccttaccccagatcacggaatcaactttgac
aatacctccgtgatcaagtcttccttgaacaaagaaagtcgcgaagactctcaagcgctg
gggtggtttagaaccattattcagtttgacaagtctgaagggattcggtggcctgatcat
tctcaagcatggggcgctgcatccctggggtcaatcgacttgtcaccctcgtcagtagca
atttcaccaagcggtttgtcctccgatggcggctgcgtcctagcaatgctcagctctaac
atggacctcactctctgggttgccggaaagaattatctgaaaggagaatggccgaaagcc
gccgacgtcacaccatttcttctggagactcacccatccgaagatattctgaaatcacag
gtcatcagcgtggcttggactccttttgccaatttcaacgtttgcccgacgcccttggtg
aacagctcttttctcgtaatcggcagcagagcaggttctatcacccttctccggtaccac
gctcacaaagagattgaacacattcacactatttcagtcgcagacaggtggataacacaa
ctagcgccatctgcatggagcctcgcatcccccggtgtttgcgaaggatacatcgcttat
ggaagtgccgacggttctgtgggtcttatcaagatcacccaggtcctacaagaaacagat
ggagaattccattttgctcaaaactttgtattggaggttaccgttgaacgcggcccggaa
ttactatttggtcctgataaaactggaattacggccttgatatgggtggacatcgttgga
agagcccattctggtcgtctgcaaacctggaatcgtgcacctctggactgtagctggcga
agaattcggctggacgggatctcgttctctcttaatcaagacacaaaagatatccgcagt
ctcatccgcattcccatcagtgtcgggaattgtttaccttcggctacgagacatactcgt
gtaatcctctccgatgggtcattccacactatccataacctctcaaaagacccctcttgg
acatctcagaaggaggatgaccagattacttcagacaacctgtctaaaacgtctcgcagt
gtcttcgtcaaggcagagcaaggcgccgttgatcagaacgatatgaaccggattactggg
acgatatcttatgacgatcatgccacttttttgtgggcttacgagacagcaaacccttca
gactttagctacaaacacgatgcgaaacatagtagcatgctgatcgctgcgcaaatgtgg
gaagacgatgaagacgatgtgcttctcagaggccttgccaacacattgaacggcgtcagg
acagccatcggctccgagcccctccacgtcctccgcccatacctcttccaccttcggaat
caacgaaagctcgcctccttacatccccacttcctcgagatcttgaagccgacattcgcg
gaccactcggttgacattcatattccacaatgtactggagaaatgacgcccgaactccgc
cgggatttcaggacgagtctttccaggcatttattcgggtgggatgtactgctttcgctt
aggatgcggctctcgctggccgactttgcttggaaactatccataagcccggaacaacaa
gcagactgcgggcatgttgctcaaggacttctcaacaccatctcacatcgtgtgctacgc
acgataattcggcacctggcttctgtcaccaactgcctccaacccaacgacgtcccattt
gcattaagaatggtggttcagtctcttctccctggtagccctccggatctatcacaagaa
ggacgagacctggcggcacttgtggagggcctcacaagcaacccatcgtctccaatatca
aacgaactaaacgaagtgtgcccggcttgcaaagtagaggttccactgcaagatatcaca
acagctgtatgtcccaacggccacacatgggcccgatgctccataacaactttcattcta
tccactcctcgggtccgaacttgcgtaggatgcagtcggaaggcgttcctccccgtgtcg
gcgccgaattcgcctgatcacagttggctaccaccaacagctcggggatgggtagttgaa
gagcttctggaggctgttcatcggtgtctgttctgcaacaacagcttcgtcagcgttctt
tga

DBGET integrated database retrieval system