KEGG   Laccaria bicolor: LACBIDRAFT_318859Help
Entry
LACBIDRAFT_318859 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lbc  Laccaria bicolor
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LACBIDRAFT_318859
Enzymes [BR:lbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LACBIDRAFT_318859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 283 aa AA seqDB search
MSKVLLLREPSQGVPDRYQTTLTSSGYRTICVPVLETVHTNLNALKDIIREPKAFRGVII
TSRRVCDAWKLALADLAESPHEDREGVARWSTVPFYVVGQATASALKELESLYAGIGFCR
LDIRGESSGTAEQLGHFILNDRTSRSGQLLYLTGDKNRDTLPNILPGGGIELHPLRVYET
QGSSTFEQELLVALESFPKDYSAWWIVYFAPSAAEFVTPILRRHFDFSLSEKTGRKMKIA
SIGPTTATFLREVLELQVDAVASKPTPEELVSSIVAFDRSHEL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtcctcctccttagggaaccatcgcaaggggtcccagatcgctaccaaacc
actctaacttcatccgggtaccgcacgatctgtgttcccgttctcgaaaccgtccacacc
aacctcaacgctctcaaggacatcatcagggaaccaaaggcgttccgcggtgtcataatc
accagtagacgggtctgcgatgcgtggaaactcgctttggctgatttggctgaatctccg
catgaagatagagagggggtagcacgctggtcgacggtgccgttctatgtcgtgggacag
gccacggcttcggcgctgaaggaattggagagtttgtatgccggtattgggttctgtcgg
ttagacattcgaggggaatcttctggcacggctgagcagcttggtcactttattttgaac
gaccggacgtcgcggtctggacaattgctatatctcactggagacaagaaccgtgatacc
ctaccaaacattctaccaggcggtggaattgaacttcaccctcttcgtgtatatgaaact
cagggctcatctacctttgagcaggaattgctcgttgctttggaatcatttccgaaagat
tattctgcatggtggatcgtttactttgcgccatccgcagccgagtttgtgacgcccatc
cttcgacgccacttcgacttctcattgtccgagaaaaccggcaggaaaatgaaaatagct
tcgatcggacctactaccgctacttttctgcgtgaagtgttagagttgcaagtggacgcg
gtagctagtaaacccaccccagaagaacttgtctcttctatcgttgcctttgatcggtct
catgaactctag

DBGET integrated database retrieval system