KEGG   Laccaria bicolor: LACBIDRAFT_318928Help
Entry
LACBIDRAFT_318928 CDS       T01044                                 

Gene name
SDG16202
Definition
histone methyltransferase
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
lbc  Laccaria bicolor
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    LACBIDRAFT_318928 (SDG16202)
Enzymes [BR:lbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LACBIDRAFT_318928 (SDG16202)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 880 aa AA seqDB search
MSNMRSVAKQSQTLSPSVPSKQVSDLSPPPPTVEDVDATPLPSFSLSTGPAMNLDVKMDF
NVKADMVASPASPSTLVADTLPQKSKSSPTPSPTPPPSTMNGTPTTTSASPPPTPVTNLR
KPSSPGPQLIGDLPIARTDALSTFNEISANNYQNKSLGRSREVLESMTCDCVYEHGVDSH
DKACGPYSDCINRLTQVECLPEDCRCRSYCQNQRFQKREYANIDIVLTEKKGFGLRAEED
LPRDTFIYEYVGDVVNPTSFKKRMRDYALEGIQHFYFMMLQKDEFIDATKGGGIGRFANH
SCSPNCYVAKWTIGHHVRMGIFAKRDIKQYEELTFNYNVDRYGHQAQICYCGEPNCVGFI
GGKTQTDIVTMDDLYLDALGITDEQDLMALKGTKKKKGKKIDDPDFMPTMKPIVEKDVPK
VVQAIRQTQSRKVLYKLLTRIKITEDQAALRQIMRLRGYTLMKNVLDDYPTNIDLILLAS
DVLQCQRLRSDACTNKVVDSRVTEPVQSCTELDNDAVKEIAQKLLEHWESLPLYNRIPKR
VKKDDEDEFPVLILANNDNDIHDSKRLKSVEDIIFRDPPVRILPPSRFVGGLPSHLIPKR
VQPPLPPHIGQDASKVAKATREEVQAIIAAAAESAAKEEEAAAAAAAEAKAKAQAAEERA
ARKKSKTPKKALTPEEKEANKEKRLLKLVGAVVVKCMSKYAKSLNHDLFKKHAKEVIAEK
EKKSSSYREGNLDALTEEKISKIKKFAKEYIAKILRKLEKSGKRDRPSSSSTIQTTPSTS
MATPNSADGDVAMDVLPMSVEEAMDMDPDSASEGEGEEEEDEGRNGAVTPAESSRISGPS
TPMHPPPADLFTAPMDVVEVVQPVDPRRRPSLDGLSSSFR
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatgcgctcagtggcaaaacagagccagactctgagcccatcagtccctagc
aagcaggtttctgatttgtctccaccaccacccacggttgaagacgttgatgccactcct
ttaccctcattttctctctcaacaggtccagccatgaatctcgatgttaagatggacttc
aacgttaaggcggacatggtcgcatctccggcctcgccctccactcttgtggcagatacg
ctgccccaaaagtccaaatcatcgcccaccccaagccctacccctccaccatccaccatg
aatggcactcccactacaacatccgcctccccacccccaacgcccgtcacgaacttacga
aagccctctagcccaggtccccagcttattggagaccttccgatcgcacgcacagacgcc
ctgagcactttcaatgagatttctgccaataattaccagaacaagtctttgggccgctcg
agagaggtcctcgaaagcatgacgtgtgattgcgtctacgaacatggcgtcgacagtcac
gacaaagcgtgtggtccgtactcagactgcattaacagattaacacaagtcgagtgcctg
cccgaggactgtcgctgtcgttcttactgccagaaccaaaggtttcagaagagagagtac
gccaatatcgacattgtcctgacggagaagaaggggtttggcttgagggcggaagaggac
cttccgagggacaccttcatctatgaatatgtcggggacgttgtcaatcctacctccttc
aagaagcgtatgcgagattatgctctcgaaggcattcaacacttttatttcatgatgctg
cagaaggatgagtttatcgacgcaacgaagggcggagggatcgggcgcttcgccaatcac
agctgcagtcccaattgctacgtcgcgaagtggacgattggacatcacgttcggatggga
attttcgcaaaacgtgacatcaagcagtatgaggagttgaccttcaattacaacgttgat
cgttacggccatcaagcccaaatatgctattgcggggaacccaactgtgtgggcttcatt
ggaggaaagactcagacggacatagtaacaatggacgacttgtatcttgatgcccttgga
atcactgacgaacaagacctcatggcgctcaaagggacaaagaagaagaagggcaagaag
atcgacgatccggatttcatgcccacgatgaagccgattgttgagaaggatgttccaaag
gtcgtgcaagccatacggcaaactcaaagtcgcaaggtcctatataagctactgacacgc
atcaagataaccgaggatcaagcagcgctgcgacagatcatgcgtttgcgtggatacacg
ctcatgaagaatgttttggatgattatccgacaaacattgacttgatattgctggcgagt
gatgtgttgcagtgtcaaaggcttcgttctgatgcgtgcacgaacaaggtcgtagattca
agagtaacggagccggtacaatcatgcactgagctcgacaacgacgcagtgaaagaaata
gcccagaagctcctcgaacattgggagagtttgcccctatacaatcgaataccaaagcga
gttaagaaggacgatgaggatgaattccccgttctcattcttgcgaacaatgataatgat
atacatgattcaaaacgcctcaagtctgttgaagacattatatttcgcgacccgccagtt
cgcatactgccgcctagtagattcgtggggggtctcccatctcatctcataccgaaacga
gtccagccgccgttaccacctcacattggccaggatgcttcaaaagttgcaaaagctaca
cgcgaggaggttcaggcgatcattgccgcggcggccgaaagtgctgccaaagaagaagaa
gccgctgccgctgccgctgctgaagccaaggccaaggcacaggctgcagaagagagggct
gcccggaaaaaatccaagacccctaagaaggccctaactcccgaggagaaggaggcgaac
aaagagaagaggctattgaaacttgttggcgcggtggtcgtgaagtgcatgtcaaaatat
gcaaagtcattgaaccatgacctgttcaagaaacatgcgaaggaggtcatcgctgagaag
gaaaagaagtcttccagttaccgtgagggaaatctggatgcgcttacagaggagaaaatc
tccaaaatcaaaaagtttgccaaggagtacattgctaaaattcttcgcaaacttgaaaag
tctggcaaacgtgacagaccttcatcctcttcaacaatacaaaccacgccatcgacgtcc
atggcgacccctaattcggctgatggggatgtggcaatggacgtgctacccatgtcagtt
gaagaggcgatggatatggatccggattcggcaagtgagggagaaggggaggaggaggag
gatgaaggacggaacggtgcagtgacgcctgcggaatcaagtaggatttctggtccgtcg
acgccgatgcacccaccgccggctgatcttttcactgctccaatggacgttgtagaagtt
gtgcagccagtagatcctcgccgtcgaccgtctctggacggtttatctagtagctttagg
tag

DBGET integrated database retrieval system