KEGG   Laccaria bicolor: LACBIDRAFT_319636Help
Entry
LACBIDRAFT_319636 CDS       T01044                                 

Gene name
HAG16201
Definition
histone acetyltransferase, GCN5 superfamily
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 398 aa AA seqDB search
MTTKTKTDPSLLEYLLTRPPDLSLGREMESRSTANFSIHPYTSTSKPPIRTEKPSVIELR
KGVIQITPVENDMLPRSLVILTGLKTLFQKQLPKMPREYIARLVYDANSKALAIIKRGFK
VVGGICYRPFPHRGFAEIVFFATNSADQEKGYGGMLMDHYKAHIRRTYPDMMHFLTYADN
FAVGYFEKQGFSKEITLDRSVWAGYIKDYEGGTIMQCTMLRKLDYLDKPRIFSQQQEAIM
TKIRQMSRSHVVHPGLPQFQPGAPADVVVDPKDVPGLKETGWSPTMTINFVCVAPKSADY
QVMERVLKSLQNHSSAWPFTKPVRIEEVPDYFDVVKRPMDLSTMEHKLTTHQYRTLEAFA
EDARLVFDNCRLYNPEHTIYAKHADKLEKAFRELMPDW
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaagacgaagacagacccctcgcttctcgaatatctgctaacacgacctccc
gatctgtcgctgggaagagaaatggaaagcaggtcaacagcgaatttttcaatccaccct
tacacgtctacctcgaagccacctatacggacagagaagccgtctgtcatagagctgcgc
aagggtgtgatacagatcacgccggtagaaaacgacatgttgcctcggtcccttgttatt
ttgaccggcctgaaaaccctgtttcaaaagcaattaccaaaaatgcctcgagaatatatt
gctcgactcgtctacgatgcaaattccaaggccttggccatcataaagcgtgggtttaag
gtcgtcggtggaatttgctatcgaccgtttccccatcgcggctttgcggaaatcgtgttc
tttgccaccaattccgcagaccaagaaaagggttatggtgggatgctgatggaccactac
aaagcccacatccgccgaacatatccagatatgatgcattttctcacttacgcagataat
ttcgctgttggctactttgaaaaacaaggattctccaaagaaatcaccctcgaccgttca
gtatgggctggatacattaaagattacgagggcggaacaattatgcaatgtacaatgctg
cgtaaacttgactacttggacaaaccgaggattttctcccagcagcaagaggccattatg
acgaagatcaggcagatgtcgcggtcacatgtcgtgcatcctggcctcccacaatttcaa
cctggggctcctgcagacgtcgtcgttgacccgaaagatgttcctggcctcaaggaaaca
ggctggtcaccaacaatgacgatcaattttgtctgcgtggctcctaagagcgcggattat
caagtcatggagcgtgtattgaagagcctacaaaatcattcgtcagcatggcctttcacg
aaacccgtacggatagaggaagtccccgattatttcgacgttgtcaagcgtcctatggac
ctaagcactatggagcataagctcacaacgcaccagtacagaaccctggaggcgtttgcc
gaggatgctcggttggttttcgacaactgccggctctataatcctgaacatacaatatat
gccaaacatgcggataagctggagaaagcatttagagaattgatgcctgactggtga

DBGET integrated database retrieval system