KEGG   Laccaria bicolor: LACBIDRAFT_321307Help
Entry
LACBIDRAFT_321307 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
lbc  Laccaria bicolor
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    LACBIDRAFT_321307
Enzymes [BR:lbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LACBIDRAFT_321307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 281 aa AA seqDB search
MTVVESWTKTGMPKKVLMRIIEENYQRTVGPNVPKLKQYEAFSSTVYGELMPNLSSEMIE
ITQLKEDSLFLDLGSGVGNVVVQASLQTGCTSYGIELMPAPARVAEDMVEQIKVRCRMWG
VKVGEMELEKGNMLTSKRVDELIAKADVVLVDNKVFEESLNEALRPKFLDLKEGAIVISL
APFVSSLNARVTERNVDDISTIFEVTERHYHSGSVSWGNSGGTYYLHRVDREGYAKIRER
FESARASSGRSTRKKPAHPKDCDADNELQDNSRFRTYRVLG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgttgagtcatggaccaagactgggatgccaaagaaggtcctcatgcgcata
atcgaggaaaactaccagcgcacagtcgggcctaacgtcccaaaactaaaacaatacgag
gctttctccagcaccgtgtacggggaattaatgcctaatctctcatccgaaatgatagaa
atcactcagctgaaagaggattctttattcctcgatctggggagtggagttgggaatgtg
gtcgtgcaagccagtctgcaaacaggatgcacgagttatggaatagagttgatgccagcc
ccagccagggtagcggaagatatggtggagcaaataaaggtccgctgtcgtatgtggggg
gtcaaggtcggcgagatggagttggagaaaggaaatatgttgacaagtaaacgggtggac
gagctcatcgccaaagctgacgttgtcttggtggataacaaggtgttcgaggagagcctg
aatgaggcattgagacccaagtttttggatctaaaggagggtgcgattgtaatatcattg
gcgccttttgtaagctccttaaatgcccgagtgacggaacgtaacgtcgacgatatcagt
acaatttttgaggtcactgaacgtcattatcactctggaagcgtttcctggggcaacagt
ggaggtacatactacctccatcgcgtggatcgtgaaggatacgcgaaaattagggagcga
tttgaaagcgctcgggcaagctcgggacgaagcacgaggaagaaaccagcacatcccaaa
gactgtgacgccgataatgaactccaggacaactcgcgctttcggacttatcgggtccta
gggtga

DBGET integrated database retrieval system