KEGG   Laccaria bicolor: LACBIDRAFT_324122Help
Entry
LACBIDRAFT_324122 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
lbc  Laccaria bicolor
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    LACBIDRAFT_324122
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     LACBIDRAFT_324122
Protein kinases [BR:lbc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   LACBIDRAFT_324122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 295 aa AA seqDB search
MGQLQLDEELGKGNYGTVKKVLHKPTNVAMAMKEIRLELEDAKLNAIIMELDVLHRAVAP
EIVEFYGAFFIESCVYYCMEYMDAGSLDKLQGAGVPEGVLGRIAGSMVRGLKFLKDDLNI
IHRGKIRFNRKGEIKLCDFGISGELDKSLAKTNIGCQSYMAPERIKGESQNNLGTYTVSS
DVWSLGLSMIEIGLGQYPYPPETYSNVFAQLTAIVHGDPPELPEEKYSEQARDWVAQCLR
KDPERRASYRELLDHPFLVENSKIEVDMVGWVERALEYRKKASTPTPVPPLPQSV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgggccaactacaactcgacgaagaactgggaaaaggaaactatggcactgtcaaaaag
gttcttcataaacccacaaacgtggccatggcgatgaaggaaattcgtctcgagcttgaa
gatgcaaagctaaacgctatcatcatggaactcgacgtccttcatcgggctgttgcacct
gaaatcgtcgaattttacggtgctttctttatcgaatcatgtgtttactattgcatggag
tacatggatgccggctccctggataaacttcagggagcaggcgttccagaaggtgtactt
ggtcgcatcgctggcagtatggttcgcgggcttaaatttctcaaggacgacctcaatatc
attcatcgaggcaaaattagattcaacagaaaaggggagatcaaactatgcgattttggc
atatcaggcgaactcgacaagtccctggcaaagacgaacattggctgtcagagttatatg
gcgccggaacgaatcaaaggagaatcacagaacaacctcgggacatacaccgtctcatcg
gacgtatggtctcttggcctatcaatgatcgagattgggcttggacaatacccctaccca
cccgaaacatactccaatgtgttcgctcaattgacggcgatcgtacatggggatcccccg
gagttgccagaagaaaagtactcggagcaagcgcgggattgggtcgcccaatgtctcagg
aaagatccagaacgaagggcgagttatcgtgagctactggaccacccattcctcgtcgaa
aactcaaagatcgaggtggatatggttggatgggttgagagggctctagaatatcgaaaa
aaggcgtcgaccccgactccagtgccgccattaccgcaatcagtgtga

DBGET integrated database retrieval system