KEGG   Laccaria bicolor: LACBIDRAFT_330895Help
Entry
LACBIDRAFT_330895 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 236 aa AA seqDB search
MAGSRWVPLESNPEANTRFWSSQAGLVPSVAEFGDIYGLDDELLSLVPQPVKAVILLFPI
SAETEAKKKEEDEKVEKDGQHAIEPKVLWIKQTISNACGTIGLLHALANSNVPFIPDSPL
AKFVDECRKITPDKRAKLLETTSLFADIHAEAATAGQTEVPRDLDTDLHFTCFVESAHDG
TGSRVIELDGRRKGPVDRGQCTNLLSDVARIVKDVYLTEGAGVNFSMMYLGPPSEF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccggtagtcgctgggtccccctcgaaagcaacccagaggcaaatactcgtttttgg
tcaagtcaagcggggctcgtaccctccgtggcggagtttggggatatctacgggctcgat
gatgaattattgagtctcgtgcctcagcctgtgaaggcggttatattgctcttcccgatt
tcggctgaaactgaagcgaagaagaaggaggaagatgagaaggttgagaaagacgggcaa
catgcgattgagcccaaggtgttgtggattaagcagacgatctctaatgcgtgtgggacc
atagggctgttgcatgccctcgcaaattcaaatgtacccttcattcctgatagtcctctg
gccaagttcgttgacgaatgccgaaaaataacaccagacaaacgcgcaaagctcctagaa
actacctccctcttcgctgacatccacgcagaagcagccacggccggccagacggaagta
ccacgcgacctcgataccgacctgcactttacctgctttgtagagtcggctcatgatggg
acgggatcgcgggttattgagcttgatggacggaggaaggggcctgtggatagagggcag
tgcacgaatttgttgagtgacgtcgcgaggattgtgaaggatgtgtatctcactgagggg
gctggggtgaatttcagtatgatgtatctcggcccaccgagtgaattttga

DBGET integrated database retrieval system