KEGG   Laccaria bicolor: LACBIDRAFT_384433Help
Entry
LACBIDRAFT_384433 CDS       T01044                                 

Gene name
HAG16203
Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
lbc  Laccaria bicolor
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 435 aa AA seqDB search
MTDWTSDANEALTLSLVRSQEDKEALAENESYIEFHPNFTYPIYGEDEKIYGYNDLVIDL
RFASGSLAQYLSVKYSEKLGSSSTVDDVEGTLAGFIPSDYYKDERAFLKRVAEEAVSFQP
TGQLISSYTRPSPLAASKGKGKGVERMQNLDPGSVDTIEFEVYHHKATWNTPGFREYHRR
MQLFILLYIEAGTYINEEDEVWEFVLLQRKRRASPHLATYHFVGYSSLYPFYHFPEKVRL
RLSQFVILTPYQRHGHGSELYNAIYQYVIRRSDVAELTVEDPAEAFEDLRDKNDLKMLLA
NEQFMQEGFGGEVSHGGGRVGGVGRTGKSGRGGTGISTKGKMGPPADKAWVEKWRKDLKI
AGRQFQRLVEMLILLRLDASDARGLRAYRLQVKERLYRFNFEILAQLEKDERHEKLEETF
QTVKEDYHRLLALVH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactgactggacttcggacgcaaatgaggctcttacactctctttagtgaggtcgcag
gaggataaagaagccttggcggaaaacgagtcctatattgaattccacccaaattttaca
tatcctatttatggagaagacgagaaaatatatggttataatgacttggtgatcgatttg
cggtttgcttctgggtctctggcccaatatctgtcagtaaaatattccgagaaattggga
tcttcttcgacagtcgatgacgtggagggaacactggccggatttataccttcagactat
tacaaagatgaaagagcttttttgaaacgcgtggcagaagaggcggtttccttccaaccg
acaggacagctcatttcaagttatactagaccttcgcctcttgctgcatccaaaggaaaa
gggaagggagtggaaagaatgcaaaatctggatccaggaagtgtagatacgatcgaattt
gaggtatatcatcacaaggcaacatggaatacacctggtttccgggaataccaccgacga
atgcaattatttattttgctatatattgaagcaggaacatatattaacgaggaggatgag
gtttgggagttcgttctactgcaacgaaagagaagggcttcgccacatctggcaacgtac
cacttcgttggctattcatcactctatcccttctaccatttccccgaaaaagtgcgctta
agactgagccaattcgtcattctcacgccatatcaacgccacgggcatggctctgaactt
tacaacgctatctatcaatatgttattcgtcggtccgatgttgcagaactaaccgtggag
gatcccgcagaggcattcgaggacctccgagacaagaatgacctcaaaatgcttcttgcc
aacgagcagttcatgcaagaaggttttggcggtgaagtgtcacatggaggtggtcgcgtg
ggcggggtggggagaacggggaagagtgggcggggaggcaccggaatatcgacgaagggg
aagatgggccctccagctgataaggcatgggttgagaagtggagaaaggatttgaaaatt
gcagggaggcagtttcaacgactcgtcgaaatgcttattcttttacgattggatgcatcc
gacgcacgcggcctgcgagcgtatcggttacaggttaaagaacgcctctatcggtttaat
tttgaaattcttgctcagctggagaaggatgagcgtcacgagaaactggaagagacattc
caaactgtgaaagaggattatcatcggcttttagccttggttcattga

DBGET integrated database retrieval system