KEGG   Laccaria bicolor: LACBIDRAFT_384857Help
Entry
LACBIDRAFT_384857 CDS       T01044                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase 1
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lbc  Laccaria bicolor
Pathway
lbc00020  Citrate cycle (TCA cycle)
lbc00310  Lysine degradation
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
lbc01200  Carbon metabolism
Module
lbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LACBIDRAFT_384857
  Amino acid metabolism
   00310 Lysine degradation
    LACBIDRAFT_384857
Enzymes [BR:lbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LACBIDRAFT_384857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-GeneID: 6074438
NCBI-ProteinID: XP_001878743
JGI: 384857
UniProt: B0D495
AA seq 433 aa AA seqDB search
MLSSRVIAIARGRGLTQASSASLLRALTIANVNAKRAQFHSSNLLKAETIKVPQMAESIS
EGTLKSWSKQVGDTVTADEEVATIETDKIDVSVNAPQSGTIVKLLANEEDTVTVGQDLFV
LEPGEVAASSPPPAKEEAVPAAEAPKESAEPAVPQPPSPSESAKTPETKEPVKAKEEKPV
KKEEKKKEDKSKPAAAPRVAGSRNETRVKMNRMRLRIAERLKESQNAAASLTTFNEIDMS
SLVEMRKKFKEQVMKDHEVKLGFMSAFAKACTFALQEIPAANASIEGEQIVYRDYVDLSV
AVATPKGLVTPVVRNAEGMSFVEIEKEIAALGKKAKDGKLTLEDMAGGTFTISNGGVFGS
LYGTPIINLPQSAVLGMHAIKDKAVVVDGQIVIRPIMIVALTYDHRLLDGREAVTFLVRV
KEYLEDPRKMLLV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctcaagggttatcgccattgctagagggcgtggcctcacacaggcctcgtcg
gcgagcctattgagggctttgactattgccaacgtcaatgcgaaaagagcccagttccac
tcgtcaaatttattgaaagcggaaaccatcaaggttccccagatggctgaatccattagt
gagggaacactcaagtcatggtcaaaacaagttggcgacaccgttaccgccgatgaagaa
gtagcgaccatcgaaaccgacaagattgatgtgtccgttaacgctcctcaatccggcaca
attgtaaagttgcttgcaaacgaagaggacaccgttactgtgggacaggacttgttcgta
cttgaacctggagaggtcgcagcatcctctcctccaccagccaaagaggaggccgttccc
gctgctgaagctcctaaagaatccgccgagcccgctgtccctcaaccaccatcaccctca
gaaagcgccaagacaccagagacgaaggagcctgtgaaggctaaggaggagaagccggtc
aagaaggaagagaagaagaaggaagacaagtcaaaaccggctgctgcaccccgcgtagct
ggtagtcgtaacgagacaagggtgaaaatgaaccgaatgcgcctgcgcatcgccgagcgt
ctcaaggagtcacaaaacgccgcagcctctttgacgaccttcaacgagatcgacatgtcc
tccctcgtcgagatgcgcaagaaattcaaagagcaagtcatgaaagaccacgaagtcaag
ctcggtttcatgtccgcctttgccaaagcttgtacctttgcgctgcaagaaatccccgcg
gccaacgctagcatcgagggggagcagattgtatacagggactacgtcgacttgagcgtg
gctgtggctactccgaagggcttggtcacccccgttgtgagaaacgcggaggggatgagt
tttgtagagattgagaaggagattgctgcccttgggaagaaggcgaaggatgggaagttg
acgcttgaggatatggccggtggaacctttacgatctccaatggtggtgtatttggctcg
ttgtacggtactcccatcatcaacttgcctcagagtgccgttctcggtatgcacgcaatt
aaggacaaggccgttgtcgttgacggtcaaattgtcatccgccccatcatgatcgtcgca
ctcacgtacgaccatcgtctgctagacggtcgggaggccgttactttccttgtgcgagtt
aaagagtacctcgaagacccacggaaaatgttgcttgtataa

DBGET integrated database retrieval system