KEGG   Laccaria bicolor: LACBIDRAFT_384857Help
Entry
LACBIDRAFT_384857 CDS       T01044                                 

Definition
dihydrolipoyllysine-residue succinyltransferase 1
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lbc  Laccaria bicolor
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACBIDRAFT_384857
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LACBIDRAFT_384857
  Amino acid metabolism
   00310 Lysine degradation
    LACBIDRAFT_384857
Enzymes [BR:lbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LACBIDRAFT_384857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 433 aa AA seqDB search
MLSSRVIAIARGRGLTQASSASLLRALTIANVNAKRAQFHSSNLLKAETIKVPQMAESIS
EGTLKSWSKQVGDTVTADEEVATIETDKIDVSVNAPQSGTIVKLLANEEDTVTVGQDLFV
LEPGEVAASSPPPAKEEAVPAAEAPKESAEPAVPQPPSPSESAKTPETKEPVKAKEEKPV
KKEEKKKEDKSKPAAAPRVAGSRNETRVKMNRMRLRIAERLKESQNAAASLTTFNEIDMS
SLVEMRKKFKEQVMKDHEVKLGFMSAFAKACTFALQEIPAANASIEGEQIVYRDYVDLSV
AVATPKGLVTPVVRNAEGMSFVEIEKEIAALGKKAKDGKLTLEDMAGGTFTISNGGVFGS
LYGTPIINLPQSAVLGMHAIKDKAVVVDGQIVIRPIMIVALTYDHRLLDGREAVTFLVRV
KEYLEDPRKMLLV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctcaagggttatcgccattgctagagggcgtggcctcacacaggcctcgtcg
gcgagcctattgagggctttgactattgccaacgtcaatgcgaaaagagcccagttccac
tcgtcaaatttattgaaagcggaaaccatcaaggttccccagatggctgaatccattagt
gagggaacactcaagtcatggtcaaaacaagttggcgacaccgttaccgccgatgaagaa
gtagcgaccatcgaaaccgacaagattgatgtgtccgttaacgctcctcaatccggcaca
attgtaaagttgcttgcaaacgaagaggacaccgttactgtgggacaggacttgttcgta
cttgaacctggagaggtcgcagcatcctctcctccaccagccaaagaggaggccgttccc
gctgctgaagctcctaaagaatccgccgagcccgctgtccctcaaccaccatcaccctca
gaaagcgccaagacaccagagacgaaggagcctgtgaaggctaaggaggagaagccggtc
aagaaggaagagaagaagaaggaagacaagtcaaaaccggctgctgcaccccgcgtagct
ggtagtcgtaacgagacaagggtgaaaatgaaccgaatgcgcctgcgcatcgccgagcgt
ctcaaggagtcacaaaacgccgcagcctctttgacgaccttcaacgagatcgacatgtcc
tccctcgtcgagatgcgcaagaaattcaaagagcaagtcatgaaagaccacgaagtcaag
ctcggtttcatgtccgcctttgccaaagcttgtacctttgcgctgcaagaaatccccgcg
gccaacgctagcatcgagggggagcagattgtatacagggactacgtcgacttgagcgtg
gctgtggctactccgaagggcttggtcacccccgttgtgagaaacgcggaggggatgagt
tttgtagagattgagaaggagattgctgcccttgggaagaaggcgaaggatgggaagttg
acgcttgaggatatggccggtggaacctttacgatctccaatggtggtgtatttggctcg
ttgtacggtactcccatcatcaacttgcctcagagtgccgttctcggtatgcacgcaatt
aaggacaaggccgttgtcgttgacggtcaaattgtcatccgccccatcatgatcgtcgca
ctcacgtacgaccatcgtctgctagacggtcgggaggccgttactttccttgtgcgagtt
aaagagtacctcgaagacccacggaaaatgttgcttgtataa

DBGET integrated database retrieval system