KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0026Help
Entry
LBF_0026          CDS       T00712                                 

Gene name
lacA
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbf00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:28169..30151
Genome map
AA seq 660 aa AA seqDB search
MIFGACYYPEQWNPKDWDEDLKMMKEMGLSSVRLAEFAWGIMEPKEGKFDFSLFDAILEK
IQKQGMTAILGTPTATFPPWLYQKFPEIVQISKEGIIRGIGTRRQACFSSPAYKKATERI
VTAMAKHFGNHPAVVGWQIDNEPGHEGSDVDYSPLAEKNFRIWLKTKYKTLDSLNKRWGN
VFWGVIYSDWNQIPLPGAHVASNFNPAMIQDYYRFQSDELVSYIHFQAEILRKYSKGKPL
TTNLYPSPFLPVTDMYEMFKKLDYVSWDNYPVWGNQQEPYPHPLVTATQQYSRGLKDKPY
TVMEQFSGVQGHDTLGYLPPPGQIGLWLTQAIVNGANQIYFFRYRTARFGQEQLCYGILD
HGKRKTSKYFELKKTIEEIKEFAEDIAASPYPAKVAILHDIENSRNYKHQPLSDGLKFSP
VPFAQVGYDIELATWFAGTNVLNVNTHSLPIQREQDWSNYKVLTLPLYTMFGPEIVEKLK
AYVQEGGTLVLGYRSGIKDKDHWMVEEPVPGVFSEMAGVEVFQFEAPATDKVGIKMGIWP
LKGSKFCEILEPTSAKVIARYRDKKKFYSGKPAITVNSFGKGKVYYVGTSLTPESFVLLY
RKILKGAGIPFGFLGATIERHFREGKKYNYEITMNHSNQYKLAGFSVLKPFGYQIKRIQK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgatctttggagcctgttattacccagaacaatggaaccctaaggactgggatgaagac
ctaaaaatgatgaaagagatgggtctttcgtctgttcgccttgcagaatttgcatggggg
atcatggaacccaaagaagggaaatttgatttttctctcttcgatgcaatcttagaaaaa
attcaaaagcaggggatgactgccatcctcggtacaccaacggccacatttcctccttgg
ttgtaccaaaaatttccagaaattgtacagatttccaaagaaggaatcattcgtgggatt
ggaacaaggcgacaagcttgtttttcctcacccgcatacaaaaaagctaccgaacgcatt
gtgacagcaatggcaaaacactttgggaaccaccccgcggttgtaggttggcaaattgac
aatgaaccaggccatgaaggttccgatgtggattattccccactggctgaaaaaaatttc
cgaatatggctgaagacaaaatataaaactctcgattcgcttaacaaacgttgggggaat
gtcttttggggagtgatctattctgactggaatcagattcccttaccaggtgcgcatgtg
gcgagtaattttaacccagccatgatccaggactattatcgtttccaatctgatgagttg
gtttcttacattcatttccaagcagaaattttacgaaaatatagcaaaggaaaaccactc
acgaccaatttatacccatcgccatttttgcctgtgacagatatgtacgaaatgttcaaa
aaattggactacgtatcttgggacaattaccctgtttgggggaaccaacaagagccttac
ccacatcctcttgtcactgccacgcaacaatactcacgcggtctaaaagacaaaccatat
acagtgatggaacaattctcaggtgtacaagggcatgatacattaggttaccttccacct
cctggtcaaattgggctttggttgacacaagcaattgtgaatggagccaaccaaatctat
tttttccgttaccgaacggctcgctttggacaagaacaactttgttatggaattttagat
catggcaaacgaaagacatccaaatactttgaattgaaaaaaaccatcgaagaaatcaaa
gaatttgcagaagacatcgctgcttcgccttacccagcgaaggttgccattttacatgac
attgaaaattcaagaaactacaaacaccaacctttgagtgatggactgaagttttcacca
gttccttttgcacaagtgggttatgacatagaacttgccacctggtttgctggcactaat
gtactgaatgtcaacactcactctttgccaatccaaagagaacaggattggtcaaattac
aaagttctcactcttcctttatacacgatgtttggtccagagattgtagaaaaattaaag
gcctatgtacaagaagggggaaccttggttctaggataccgatcgggaatcaaagacaaa
gaccattggatggtggaagaaccagtccctggagtgttttcagaaatggcaggcgtggaa
gtatttcaatttgaagcacctgcgacagataaggtgggaatcaaaatggggatttggcca
ctcaaaggatccaaattttgtgaaatcttagaaccaacctcagccaaagtgatcgcacgt
taccgtgataaaaagaaattttattcaggtaaacctgctatcacagtgaattcctttggg
aaaggaaaagtctattatgtaggcacttctttaacaccagaaagttttgtcctcttgtat
cgaaaaatactgaaaggagccggtattccttttggtttccttggagctacgatcgaaagg
cattttcgagaggggaaaaaatacaattatgaaatcacgatgaaccattcgaatcaatat
aaattggctggtttttcggtattaaagccgtttgggtatcaaatcaaacggatccagaaa
taa

DBGET integrated database retrieval system