KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0261Help
Entry
LBF_0261          CDS       T00712                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:269620..270093
Genome map
AA seq 157 aa AA seqDB search
MKYSNIAFLSLGSNIGDRHHFMDQAIWEISTLPELQILKQSERLETAPLENTNQPYFLNQ
ILKVMVSSAFTLPCLLDSLQGIEDKLGRKRRSWKGPREIDIDILTYEAVVMKTDFLHLPH
HSLYSRPFIKQLLTDMGEIGVYALYTELNHEKHYSTV
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattccaatattgcctttttgtctttaggatccaacataggtgacagacaccat
tttatggaccaggcaatttgggaaatatccaccttacctgaattacagattctgaaacaa
tcagaacggttggaaactgcaccactcgaaaataccaaccaaccttattttttaaatcaa
atcctaaaggtgatggtgtcctctgctttcacactgccatgtttattagattctttgcaa
gggatcgaagacaaattgggacgcaaacgtaggtcttggaaaggaccacgcgaaattgat
atcgatattctcacttacgaagccgtggtgatgaaaacagattttttacatttaccccac
cattccctgtattccagaccattcattaagcagttgttaactgacatgggtgagattggt
gtgtatgccctctatacggaactgaaccatgaaaaacattattctacagtataa

DBGET integrated database retrieval system