KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0277Help
Entry
LBF_0277          CDS       T00712                                 

Definition
oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    LBF_0277
Enzymes [BR:lbf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     LBF_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:285215..286963
Genome map
AA seq 582 aa AA seqDB search
MNQTIPKEQKFDYDVIIVGSGFGGSVSAYRLSQKGYKVLVIESGKRWKAGDFPKTNWSLR
KYLWMPKLGFYGIQRINLLNDFLLVSGSGVGGGSLVYACTLYVPSSKVLNSPLYSKMGGE
KALLPYYVVAKHMLGVTENPQLWEPDHLLLETAKSFGKEDTFRRTPVGIYFGNKKDLKDP
FFEGDGPDRDPCNYCGGCMVGCRHNAKNTLDKNYLYLAEKLGAVILPETKVTSLIPLNEK
GIPDPEASGEFGYELETKSTTGWFGYPKSKFRSNQVVLSAGVMGTVGLLLKMQQENKMIR
LSEKLGDTVRTNSETVLPVTVPASHNADYSRGIAITSSVHPDENTHIEPVRYSKGSDFFG
VLASVMTDGGGKFPRPLKFFWTMVRHPLYFLKAHNPFGFAKNSIILLVMQTVDNSVRLVR
KRRFIWPFQRTITSALSTGEPTPTYIPIANAFTRKLAEIVGGIPRSSLNETLLSAPVTGH
IMGGCIVAESPEKGVIDLENKVFGYENLRVCDASMLTVNLGVNPSLTITALSERAMSLIP
PKETTQIQFLKFEVKRGFDKTIAFKPTKRVVKKSTTTRKQLS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaccattccaaaagaacaaaaatttgattacgacgtgatcatcgttgggtca
ggatttggtggttctgtttctgcgtatcgtctttcgcaaaaagggtacaaagtattagtc
atagaatccggaaaaagatggaaggcaggtgactttcctaaaaccaattggagtctacga
aagtatttgtggatgcccaaattaggtttttatggaatccaacgaatcaatttactgaat
gattttttacttgtgagcggatcaggtgttggtggtggctcactcgtatatgcctgtact
ttatatgtgccttcatccaaagttttaaattcaccattgtattccaagatgggtggagag
aaagctttgttaccttattatgttgtagcaaagcatatgttaggtgttacggaaaatcca
caattgtgggaaccagatcatttattacttgaaacggcaaaatcatttggaaaagaagat
acattccgaaggacaccagttggaatttatttcggaaacaaaaaagatcttaaagatcct
ttttttgaaggagatggccctgaccgtgatccttgtaattattgtggtggttgtatggtg
gggtgccgacacaatgcaaaaaatacattggataaaaactatttgtacttagcagaaaag
ttaggtgctgtcatattacctgaaacaaaggtaacttcactcatccctctcaatgaaaaa
ggaatcccagatcctgaagcaagtggcgaatttggatatgagctggaaaccaagagtaca
actggttggtttgggtatcctaaaagtaaatttcgttcgaatcaagtggttctatctgct
ggagtcatgggaactgttggcttactcctcaagatgcaacaagaaaacaaaatgatccga
ttgtcagagaagttaggtgatacggttcgtacgaatagtgagactgttttgccagtcaca
gtaccagcaagtcacaatgctgactattccagagggattgctatcacatcctcagtccat
cctgatgaaaatactcacattgaacctgtacgttattccaaaggttctgatttttttgga
gtccttgccagtgtgatgacagacggtggtggaaagtttccaaggccattgaaatttttt
tggaccatggtgcgccacccactttattttttaaaggcccacaatccgtttggttttgca
aaaaactcgatcatcttacttgtcatgcaaacggtagacaatagtgtgcgactggttcga
aagaggcgcttcatttggcccttccaaagaacgatcacttcagccctgtccacaggagag
ccaacaccaacatacattccgatcgccaatgcgtttactcgaaaattagcagaaattgtt
ggtggaatcccacgtagttctcttaacgaaactttactatcggcacctgtgacaggtcac
atcatgggtggttgtattgttgccgagtcaccagagaaaggtgtgattgatttggaaaac
aaagtatttggatacgagaatttacgagtttgtgatgcttcgatgttaacagtcaacttg
ggtgtgaatccaagtcttaccatcactgctttatcggaacgtgcgatgagccttatccca
ccaaaagaaacaacacagattcaatttttgaagtttgaagtgaaacgtggatttgacaaa
acaattgccttcaaacccactaaacgtgttgttaaaaaatcgacaacgacaaggaaacaa
ttatcgtaa

DBGET integrated database retrieval system