KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0610Help
Entry
LBF_0610          CDS       T00712                                 

Gene name
btuE-2
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lbf00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lbf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:645917..646459
Genome map
AA seq 180 aa AA seqDB search
MQRKVLFAIFLFVSFSLIAGGKKMTFHDLKTITIQGKEISLGEYKGHPVLVVNVASKCGY
TPQYEGLEKLHLAYKDKGLKVVGFPSNDFGGQEPGTEAQIAEFCKLNFGVSFDLMKKTKV
LGNDKDPVYQFLTENAKEKGDVKWNFEKFLIDKNGNIVNRFPSSTKPESVELKQAIESIL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaagaaaagttttgtttgctatttttctatttgtcagttttagtctgattgctgga
ggaaaaaaaatgactttccatgatttaaaaaccatcaccatccaaggaaaagaaatttcg
ctcggagaatacaaaggccacccagtgcttgtggtcaatgttgcatctaaatgtggttat
acgccacaatatgaaggattggaaaaactccacttagcatacaaagacaaaggtttgaaa
gtcgttggttttccatccaatgatttcggtggccaagagccaggaacggaagcccaaatt
gcagaattttgtaagctcaattttggtgttagttttgatctaatgaaaaaaaccaaagtg
cttggaaatgacaaggatccagtttaccaatttcttacagagaacgcaaaagaaaaaggg
gatgtaaaatggaactttgaaaagtttctcatcgataaaaatggaaatatagtgaaccga
ttcccttcttctaccaaaccagaaagtgtcgaactcaaacaagccattgaaagcatctta
taa

DBGET integrated database retrieval system