KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0747Help
Entry
LBF_0747          CDS       T00712                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBF_0747
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBF_0747
   00600 Sphingolipid metabolism
    LBF_0747
Enzymes [BR:lbf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LBF_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(794296..796182)
Genome map
AA seq 628 aa AA seqDB search
MKIQYRVHNSVTISRFLPVKAGVFQSECKKFELLLTTTKDSKLGTVLSPKLIWRESTRPE
VGFSVDHLELELTDLPEGNGFSLFQHGYQSWSISRKVESSDTDRSPLLSFLHYSQENVYS
KNEAKVGKFISEYLTLLYNKESQNGVLYAPLEAGEFGTKFEVVFGNEGNVTSVKVIYDVH
CLPDLRPNAKLNISKIKVLFFKGSPETKLLKYFEELGKKEGPANLPKKVPTGWCSWYYYY
TNIDQKTILDNLTKVRELNLPFEFFQIDDGYQKEIGDWLIPNEKFPGGMRILADEIKRVG
LKPGIWLAPFLVRKKSEFFRKYPEAILKDQNGKPVPALYNPLWGRGYTYALDITHPTALA
YIEKVFTTLVKEWGYPYLKLDFLYAGLLPGDVYNKTLSPQARYQNALELIRKIVGKNTFL
LGCGAPMLPSIGFFDGMRISCDVAPFWNPERIRILLKDRNALCTKKALINDITRSSMHRH
LWLNDPDCLLVRKKKNKMNEAQTKLMASVMAVSGGMLLVSDDLTKLEMDRLDLLKKAFQL
NRECQAYTPIPIGIFENEFPLALYNPGGYLGIWNPTEEEKIVKFTLPPGVKTKAPFLDFW
TGTRVDLHPVDGGFETTLPAFGSVVVSV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaatatagagttcataattccgtcaccatttcccgtttcctccctgtgaaa
gcaggtgttttccaatctgaatgtaaaaagttcgaacttttacttacgaccacaaaagac
tcaaaactaggaactgtcctcagccctaaattgatctggagagagagcactcgtcccgaa
gtcggattttctgtcgaccatctggaattagagctcacagacctacccgaagggaatggg
tttagcctcttccaacatggataccaatcctggtcgatctcaaggaaagtggaaagttct
gataccgataggtctcctctcttatcttttttgcactactcccaagagaatgtttattcc
aagaatgaagcgaaggttggaaaatttatctcggaatacctgacccttctttataataaa
gaatcacaaaatggtgttttgtatgcacctctcgaagcgggagaatttggaacgaagttt
gaagtagtctttggtaatgaaggaaatgtaacttccgttaaagttatatatgatgtccat
tgccttcctgatttgcgtcccaatgcaaaactaaatatttccaaaatcaaagttttgttt
tttaaaggttcccctgaaactaaattattaaaatactttgaagaacttggtaaaaaagaa
ggtcccgccaatttacctaaaaaagttcccactggttggtgttcttggtactattattat
acaaacattgatcaaaaaaccattttggacaatctaacgaaagttagagaactcaattta
ccttttgaatttttccaaattgatgatgggtaccaaaaagaaattggagattggctcatt
ccaaatgaaaaattccctggagggatgcgaatccttgcggatgaaatcaaacgtgttgga
ctcaaacccgggatatggcttgcccctttccttgtccgaaaaaaatcagaattctttcgc
aaataccctgaggccattctcaaagaccaaaatggcaaaccagttcccgcattgtacaat
cctttatggggaagaggttatacctatgctctcgatatcacacatccgacagcattagct
tacatagaaaaggtattcacaacacttgtcaaagaatggggttacccttatttgaaattg
gactttttgtatgcaggacttttgccaggggatgtatataacaaaactttatcgccccaa
gctcgttaccaaaatgcattggaactcatccgaaaaatcgttgggaaaaatacattccta
ttaggatgtggtgctcctatgttaccatcgattggattttttgatggaatgagaatttct
tgtgatgtggctccattttggaatccagaaagaatacgaatcttacttaaagatcgaaat
gcactttgtaccaaaaaagctctcatcaatgatatcactaggtcttcgatgcacagacat
ttgtggctcaatgatccggattgtttactcgtccgcaaaaaaaagaacaaaatgaacgaa
gcacaaacgaaactgatggcttccgtcatggcagtgtcaggtggtatgttactggtctcg
gatgatttgacaaaattagagatggatcgtttggatctcttaaaaaaagccttccaattg
aatagagaatgccaagcctacactccgatccccattggaatttttgagaatgaattccca
ctcgcactctacaacccaggtgggtatttaggaatttggaatccaacagaagaagaaaaa
attgtaaaattcacattacctccaggtgttaaaaccaaagccccatttttggatttttgg
actggcacacgagtggatttacatcctgttgacggtggatttgaaaccactttgcctgca
tttggttctgttgtggtttctgtttaa

DBGET integrated database retrieval system